hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-12270529/chunk_1/iprscan-20090525-12270529.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05752 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00212 256.5 2.2e-72 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00212 1/1 12 155 .] 1 144 [] 256.5 2.2e-72 Alignments of top-scoring domains: SM00212: domain 1 of 1, from 12 to 155: score 256.5, E = 2.2e-72 *->kRlqkElkelqkdpppgisaipvd.nlleWtvtIvGPpdTpYEgGvf kR+ kEl +l +dpp ++sa+pv +++++W++tI GP d+pY+gGvf bm05752 12 KRINKELSDLARDPPAQCSAGPVGdDMFHWQATIMGPNDSPYQGGVF 58 kltieFPedYPfkPPkvkFitkiyHPNvdsssGeiCLdILkekWsPaltl lti+FP dYPfkPPkv F+t iyHPN++ s+G+iCLdIL +WsPalt+ bm05752 59 FLTIHFPTDYPFKPPKVAFTTRIYHPNIN-SNGSICLDILRSQWSPALTI 107 etvLlsiqsLLnePnpdsPlnvdaaelyrkdreefkkkvrewtkkyae<- ++vLlsi+sLL +Pnpd+Pl +++a y++dr +++++ rewt+kya+ bm05752 108 SKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 155 * bm05752 - - //