hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-01485108/chunk_1/iprscan-20080808-01485108.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05940 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00006 415.0 4.1e-120 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00006 1/1 52 217 .. 1 180 [] 415.0 4.1e-120 Alignments of top-scoring domains: SM00006: domain 1 of 1, from 52 to 217: score 415.0, E = 4.1e-120 *->gaaeakaePQiAmlCGrlnlhmnlqtseeGrWetDpsrtktGPtCLr gaaea++++Q+A+lCGrl+lh++l+t GrWe+Dp+r+++ CLr bm05940 52 GAAEAPGSAQVAGLCGRLTLHRDLRT---GRWEPDPQRSRR---CLR 92 dKedvLqYCrkaYPelqITNvvEasqpvkIedWCrrgrsnAAqCkghhhs d+++vL+YCr++YPelqI++v++a+q++++e+WC+++rs+ +C+++hh+ bm05940 93 DPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSG--SCAHPHHQ 140 ViPFrCLvGEFvSdALLVPegCqFlHqermdqCedhqrWhqeakeaCsek V+PFrCL+GEFvS+ALLVPegC+FlHqermdqCe+++r+hqea+eaCs++ bm05940 141 VVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQ 190 kskGnkgmilrsfgMLLPCGiDkFrGVEFVCCP<-* g+il+++gMLLPCG+D+FrGVE+VCCP bm05940 191 ------GLILHGSGMLLPCGSDRFRGVEYVCCP 217 //