hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-01353583/chunk_1/iprscan-20090618-01353583.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm06111 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00431 142.3 5e-38 1 SM00355 41.5 1.1e-07 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00431 1/1 99 211 .. 1 113 [] 142.3 5e-38 SM00355 1/2 467 489 .. 1 23 [] 22.1 0.078 SM00355 2/2 495 517 .. 1 23 [] 19.4 0.51 Alignments of top-scoring domains: SM00431: domain 1 of 1, from 99 to 211: score 142.3, E = 5e-38 *->pEifRqrFRqFrYqEtsGPREALSRLRELCrqWLRPElhTKEQILEL E +R+rFR F YqE++GP+ +L RL ELCrqWL PE ++KEQ LEL bm06111 99 LEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL 145 LVLEQFLTILPgELQaWVrehhPeSGEEAVtLlEdLereLdepgqqVsah LVLEQFL ILP + WV ++PeS + A+ L+E+L L+epg + bm06111 146 LVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGSP 195 vhgqevLleemvplga<-* + +L++ + + bm06111 196 AGSSSILSDGVYERHM 211 SM00355: domain 1 of 2, from 467 to 489: score 22.1, E = 0.078 *->ykCpigCgksfssk.aLkrHmrvH<-* y C + Cg+ f + ++L +H +H bm06111 467 YACGE-CGEAFAWLsHLMEHHSSH 489 SM00355: domain 2 of 2, from 495 to 517: score 19.4, E = 0.51 *->ykCpigCgksfssk.aLkrHmrvH<-* y C+ C k+f+ aL +H+++H bm06111 495 YACQG-CWKTFHFSlALAEHQKTH 517 //