hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-01542013/chunk_1/iprscan-20090618-01542013.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm06951 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00724 278.8 4.2e-79 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00724 1/1 157 358 .. 1 230 [] 278.8 4.2e-79 Alignments of top-scoring domains: SM00724: domain 1 of 1, from 157 to 358: score 278.8, E = 4.2e-79 *->kkfkEsswrlvsylhsvvaglyvlyslpswfsdpkscwegpsypiqg kkf+E+swr+++yl s+v gl+vly++ w+++p+ cw+ yp q+ bm06951 157 KKFCEASWRFLFYLSSFVGGLSVLYHES-WLWAPVMCWDR--YPNQT 200 msplakfyylfslGYfiydlvalllfqdlkrkDefwemlvHHivtlllis ++p+++++yl++lG+++++l+ l +d+krkD f+e+++HH+v+++l++ bm06951 201 LKPSLYWWYLLELGFYLSLLIRLP--FDVKRKD-FKEQVIHHFVAVILMT 247 lsyvlnftrvglllllllhElSdpfLelrkllkyagkkkkseyrlfslly +sy n++r+g+l +lllh+ Sd++Le++k+ +y+ ++ ++ bm06951 248 FSYSANLLRIGSL-VLLLHDSSDYLLEACKMVNYMQ---------YQQVC 287 dvnfilfavvFfvfRlilfpfliltvtvhyaqvlsgpldlskvakgvfpp d++f++f +vFf++Rl+lfp +il+++++++ + gp + bm06951 288 DALFLIFSFVFFYTRLVLFPTQILYTIYYESISNRGP------------F 325 llyllflallliLqllniyWfflilrmarklls<-* ++y++f++ll+ Lqll+++W++lilrm++ + + bm06951 326 FGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMK 358 //