hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-02000708/chunk_1/iprscan-20090618-02000708.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm07084 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00132 147.7 1.2e-39 2 SM00389 90.6 1.9e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00132 1/2 40 91 .. 1 52 [] 72.0 7.5e-17 SM00132 2/2 99 154 .. 1 52 [] 75.7 5.6e-18 SM00389 1/1 217 279 .. 1 63 [] 90.6 1.9e-22 Alignments of top-scoring domains: SM00132: domain 1 of 2, from 40 to 91: score 72.0, E = 7.5e-17 *->kCagCgkpItgdevlralgkvwHpeCFkCskCkkpLggtffekdgkl +CagC++pI +++ l++l+++wH++C +C++Ck++L++++f+++gkl bm07084 40 HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKL 86 yCkdc<-* yCk++ bm07084 87 YCKND 91 SM00132: domain 2 of 2, from 99 to 154: score 75.7, E = 5.6e-18 *->kCagCgkpItg.devlralgkvwHpeCFkCskCkkpLgg...tffek kCagC ++I+++d v+ra+ kv+H +CF+C +C+k+L+++++ ++ + bm07084 99 KCAGCAQGISPsDLVRRARSKVFHLNCFTCMMCNKQLSTgeeLYIID 145 dgklyCkdc<-* ++k+ Ck + bm07084 146 ENKFVCKED 154 SM00389: domain 1 of 1, from 217 to 279: score 90.6, E = 1.9e-22 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv +r +Rt++ Qle+L+++F+ +p+P+r+ re+LA+e+gL r+++v bm07084 217 RRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQV 263 WFQNRRakwkrqekkk<-* WFQNRR k++r+++ + bm07084 264 WFQNRRSKERRMKQLS 279 //