hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-02062593/chunk_1/iprscan-20090618-02062593.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm08395 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01529.11.fs DHHC zinc finger domain 106.4 1.5e-29 1 PF01529.11.ls DHHC zinc finger domain 105.6 1.4e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01529.11.ls 1/1 157 219 .. 1 66 [] 105.6 1.4e-28 PF01529.11.fs 1/1 166 219 .. 12 66 .] 106.4 1.5e-29 Alignments of top-scoring domains: PF01529.11.ls: domain 1 of 1, from 157 to 219: score 105.6, E = 1.4e-28 *->ldndkfikdnfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC ++ C+kC + K P+R+hHCs Cn+CVl+mDHHCpW+nnC bm08395 157 RNDIATVSI--CKKCIYPK-PARTHHCSICNRCVLKMDHHCPWLNNC 200 VGlrNyryFllFlfylill<-* VG+ N+ryF+ F+f+++l+ bm08395 201 VGHYNHRYFFSFCFFMTLG 219 PF01529.11.fs: domain 1 of 1, from 166 to 219: score 106.4, E = 1.5e-29 *->CskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnCVGlrNyryFll C+kC + K P+R+hHCs Cn+CVl+mDHHCpW+nnCVG+ N+ryF+ bm08395 166 CKKCIYPK-PARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFS 211 Flfylill<-* F+f+++l+ bm08395 212 FCFFMTLG 219 //