hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-02125139/chunk_1/iprscan-20090618-02125139.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm09321 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.ls Helix-loop-helix DNA-binding domain 74.3 3.7e-19 1 PF00010.16.fs Helix-loop-helix DNA-binding domain 72.3 8.5e-19 1 PF07527.3.fs Hairy Orange 64.9 7.8e-18 1 PF07527.3.ls Hairy Orange 66.8 6.3e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 95 148 .. 1 53 [] 72.3 8.5e-19 PF00010.16.ls 1/1 95 148 .. 1 53 [] 74.3 3.7e-19 PF07527.3.fs 1/1 164 210 .. 1 48 [] 64.9 7.8e-18 PF07527.3.ls 1/1 164 210 .. 1 48 [] 66.8 6.3e-17 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 95 to 148: score 72.3, E = 8.5e-19 *->rRrahnarERrRRdriNdafeeLrellPtla....pskKlsKaeiLr rRr ++E+rRRdriN++++eLr+l+P+ a +++ s Kl+KaeiL+ bm09321 95 RRR--GIIEKRRRDRINNSLSELRRLVPS-AfekqGSAKLEKAEILQ 138 lAveYIksLq<-* ++v+++k+L+ bm09321 139 MTVDHLKMLH 148 PF00010.16.ls: domain 1 of 1, from 95 to 148: score 74.3, E = 3.7e-19 *->rRrahnarERrRRdriNdafeeLrellPtla....pskKlsKaeiLr rRr ++E+rRRdriN++++eLr+l+P+ a +++ s Kl+KaeiL+ bm09321 95 RRR--GIIEKRRRDRINNSLSELRRLVPS-AfekqGSAKLEKAEILQ 138 lAveYIksLq<-* ++v+++k+L+ bm09321 139 MTVDHLKMLH 148 PF07527.3.fs: domain 1 of 1, from 164 to 210: score 64.9, E = 7.8e-18 *->dkyraGfseClnEvarfLsshegldetkdpvrarLlsHLqhclnelp d+++ Gf+eCl+Evar+Ls +egld++ dp+r rL+sHL++++++++ bm09321 164 DYRSLGFRECLAEVARYLSIIEGLDAS-DPLRVRLVSHLNNYASQRE 209 q<-* bm09321 210 A 210 PF07527.3.ls: domain 1 of 1, from 164 to 210: score 66.8, E = 6.3e-17 *->dkyraGfseClnEvarfLsshegldetkdpvrarLlsHLqhclnelp d+++ Gf+eCl+Evar+Ls +egld++ dp+r rL+sHL++++++++ bm09321 164 DYRSLGFRECLAEVARYLSIIEGLDAS-DPLRVRLVSHLNNYASQRE 209 q<-* bm09321 210 A 210 //