hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-12332361/chunk_1/iprscan-20090525-12332361.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bn02132 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00254.18.fs FKBP-type peptidyl-prolyl cis-trans isomeras 26.5 7.5e-07 1 PF07719.7.fs Tetratricopeptide repeat 27.0 1.6e-06 2 PF07719.7.ls Tetratricopeptide repeat 31.0 3.8e-06 2 PF00254.18.ls FKBP-type peptidyl-prolyl cis-trans isomeras 14.5 0.00016 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00254.18.fs 1/1 53 120 .. 1 76 [. 26.5 7.5e-07 PF00254.18.ls 1/1 53 185 .. 1 111 [] 14.5 0.00016 PF07719.7.ls 2/2 295 328 .. 1 34 [] 24.2 0.00044 Alignments of top-scoring domains: PF00254.18.fs: domain 1 of 1, from 53 to 120: score 26.5, E = 7.5e-07 *->gdgprkpkkGDtVtvhYtGkLe.d..GtvFDsslGydekkkkkgrgk g+ p ++G ++t+hY L +d++Gtv D+s + rgk bn02132 53 GELPD-FQDGTKATFHYRT-LHsDdeGTVLDDS--RA-------RGK 88 PfeFtlGsGqVIkGwdeGllgMkvGEkrkltI<-* P e+++G++ ++ w+ + +M++GE++++ + bn02132 89 PMELIIGKKFKLPVWETIVCTMREGEIAQFLC 120 PF00254.18.ls: domain 1 of 1, from 53 to 185: score 14.5, E = 0.00016 *->gdgprkpkkGDtVtvhYtGkLe.d..GtvFDsslGydekkkkkgrgk g+ p ++G ++t+hY L +d++Gtv D+s + rgk bn02132 53 GELPD-FQDGTKATFHYRT-LHsDdeGTVLDDS--RA-------RGK 88 PfeFtlGsGqVIkGwdeGllgMkvGEkrkltIPpelaYGeq......... P e+++G++ ++ w+ + +M++GE++++ + + + bn02132 89 PMELIIGKKFKLPVWETIVCTMREGEIAQFLCDI------Khvvlyplva 132 ..........d..e.........................eGlaggvlfaI ++ ++ ++d+ e++++ + + +++++ ++ + + + + bn02132 133 kslrniavgkDplEgqrhccgvaqmrehsslghadldalQQN-P------ 175 PPnatLvFeVELl<-* ++L+F E l bn02132 176 ---QPLIFHMEML 185 PF07719.7.ls: domain 2 of 2, from 295 to 328: score 24.2, E = 0.00044 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ++a++ +G+a+++ + +eA +++ k+leldP bn02132 295 VKAYFKRGKAHAAVWNAQEAQADFAKVLELDPAL 328 //