hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20090416/iprscan-20090416-12483498/chunk_1/iprscan-20090416-12483498.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bn02188
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model       Description                                 Score    E-value  N 
--------    -----------                                 -----    ------- ---
PF01920.10.fs Prefoldin subunit                            22.3    1.5e-05   1

Parsed for domains:
Model       Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------    ------- ----- -----    ----- -----      -----  -------
PF01920.10.fs   1/1      76   122 ..    52    98 ..    22.3  1.5e-05

Alignments of top-scoring domains:
PF01920.10.fs: domain 1 of 1, from 76 to 122: score 22.3, E = 1.5e-05
                   *->GgvLvkqdkeevkeeLeerketlekeiktLekqleklekeleelkee
                      G++++k++ +e+ke+ e++++ l+kei++L+kql+ +  +l e + +
     bn02188    76    GNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGK 122  

                   <-*
                      
     bn02188     -     -    

//