hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-02522555/chunk_1/iprscan-20090618-02522555.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bn03622 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00210.14.ls Ferritin-like domain 262.9 6.1e-76 1 PF00210.14.fs Ferritin-like domain 261.0 2.3e-75 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00210.14.fs 1/1 55 196 .. 1 155 [] 261.0 2.3e-75 PF00210.14.ls 1/1 55 196 .. 1 155 [] 262.9 6.1e-76 Alignments of top-scoring domains: PF00210.14.fs: domain 1 of 1, from 55 to 196: score 261.0, E = 2.3e-75 *->eaaLNeqlnlELyAsylYlsmaayfdrdhwglkGfakfflhesqEEl eaa+N+q+nlELyAsy+Ylsm++yfdrd+++lk+fak+flh+s+EE bn03622 55 EAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEE- 100 yeelreHAdklaerilqlGGrpvlqdikkllelsspeeppeewesvleal reHA+kl++ ++q+GGr+ lqdikk ++ ++wes+l a+ bn03622 101 ----REHAEKLMKLQNQRGGRIFLQDIKK--------PDCDDWESGLNAM 138 eaaLalEkevtqsLleliavaeeegDpvtadfLegefLaeqeehikmlea e+aL+lEk v+qsLlel+++a +++Dp+++df+e+++L eq+++ik+l++ bn03622 139 ECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGD 188 qldnlkrl<-* +++nl+++ bn03622 189 HVTNLRKM 196 PF00210.14.ls: domain 1 of 1, from 55 to 196: score 262.9, E = 6.1e-76 *->eaaLNeqlnlELyAsylYlsmaayfdrdhwglkGfakfflhesqEEl eaa+N+q+nlELyAsy+Ylsm++yfdrd+++lk+fak+flh+s+EE bn03622 55 EAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEE- 100 yeelreHAdklaerilqlGGrpvlqdikkllelsspeeppeewesvleal reHA+kl++ ++q+GGr+ lqdikk ++ ++wes+l a+ bn03622 101 ----REHAEKLMKLQNQRGGRIFLQDIKK--------PDCDDWESGLNAM 138 eaaLalEkevtqsLleliavaeeegDpvtadfLegefLaeqeehikmlea e+aL+lEk v+qsLlel+++a +++Dp+++df+e+++L eq+++ik+l++ bn03622 139 ECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGD 188 qldnlkrl<-* +++nl+++ bn03622 189 HVTNLRKM 196 //