hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-02584658/chunk_1/iprscan-20090618-02584658.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bn03774
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00248                                                  71.2    1.3e-16   4

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00248    1/4     147   176 ..     1    30 []    23.3    0.035
SM00248    2/4     180   209 ..     1    30 []    18.4        1
SM00248    3/4     213   242 ..     1    30 []    28.0   0.0013
SM00248    4/4     246   275 ..     1    30 []     1.5  2.9e+03

Alignments of top-scoring domains:
SM00248: domain 1 of 4, from 147 to 176: score 23.3, E = 0.035
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                       G+TpL +A + g +e+v++Ll+ gad+++   
     bn03774   147    RGFTPLIWASAFGEIETVRFLLEWGADPHI    176  

SM00248: domain 2 of 4, from 180 to 209: score 18.4, E = 1
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      +  ++L lA   g+ ++v lLl++++din+   
     bn03774   180    ERESALSLASTGGYTDIVGLLLERDVDINI    209  

SM00248: domain 3 of 4, from 213 to 242: score 28.0, E = 0.0013
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      +G TpL +A++ +++++v++Ll +gad++    
     bn03774   213    NGGTPLLYAVRGNHVKCVEALLARGADLTT    242  

SM00248: domain 4 of 4, from 246 to 275: score 1.5, E = 2.9e+03
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                       G+Tp+ lA++ g+ +v + + ++   +     
     bn03774   246    SGYTPMDLAVALGYRKVQQVIENHILKLFQ    275  

//