hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-12530626/chunk_1/iprscan-20090525-12530626.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ee03533 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00315 196.4 2.7e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00315 1/1 689 805 .. 1 121 [] 196.4 2.7e-54 Alignments of top-scoring domains: SM00315: domain 1 of 1, from 689 to 805: score 196.4, E = 2.7e-54 *->sleklLendpiGrllFreFLksefseykenleFWlaveefkkaed.e sleklL +++G+++F+ FL++efse enleFWla+e+fkk ++++ ee03533 689 SLEKLL-VHKYGLAVFQAFLRTEFSE--ENLEFWLACEDFKKVKSqS 732 ersskAreIydkylspeapkesevnldsdtreeieenleepppdlFdeAq ++ skA++I+ +y++ +a k evnlds+tre++++nl+++++++Fd Aq ee03533 733 KMASKAKKIFAEYIAIQACK--EVNLDSYTREHTKDNLQSVTRGCFDLAQ 780 revyellekdsyprFLkSdyYlrfL<-* ++++ l+ekdsyprFL+Sd+Yl++ ee03533 781 KRIFGLMEKDSYPRFLRSDLYLDLI 805 //