hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090526/iprscan-20090526-15320276/chunk_1/iprscan-20090526-15320276.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ee09753 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00297 141.1 1.1e-37 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00297 1/1 725 833 .. 1 118 [] 141.1 1.1e-37 Alignments of top-scoring domains: SM00297: domain 1 of 1, from 725 to 833: score 141.1, E = 1.1e-37 *->spk.qkklqellkallekldshgvpssrGrplawpFlepvdkkeLgv + k+ +l++ lk ll++++sh p awpF+epv+k+e + ee09753 725 ELKdPDQLYTTLKNLLAQIKSH--------PSAWPFMEPVKKSE--A 761 PDYydiIkkPMDLktIkkklengkYssleeFvaDfnLmfsNAktYNepds PDYy++I+ P+DLkt+ ++l++++Y++++ FvaD++++ N++ YN+pds ee09753 762 PDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDS 811 evykdAkkLeklfeeklkelpp<-* e+ ++A Lek+f klke ee09753 812 EYCRCASALEKFFYFKLKEGGL 833 //