hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-13262451/chunk_1/iprscan-20090525-13262451.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ee24251 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00401 164.4 1.1e-44 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00401 1/2 394 445 .. 1 54 [] 68.8 6.9e-16 SM00401 2/2 448 498 .. 1 54 [] 95.6 5.7e-24 Alignments of top-scoring domains: SM00401: domain 1 of 2, from 394 to 445: score 68.8, E = 6.9e-16 *->kgsgrrCsnCgtttTplWRrgpsGnqktLCNACGLyykkhgvkkrpl ++ r+C nCg+ +TplWRr+++G +LCNACGLy k++g ++ + ee24251 394 LSESRECVNCGSIQTPLWRRDGTG--HYLCNACGLYSKMNGLSRPLI 438 slkkdgi<-* + +k ++ ee24251 439 KPQKRVP 445 SM00401: domain 2 of 2, from 448 to 498: score 95.6, E = 5.7e-24 *->kgsgrrCsnCgtttTplWRrgpsGnqktLCNACGLyykkhgvkkrpl ++ g +C+nC+tttT+lWRr+ +G ++CNACGLy k+hgv rpl ee24251 448 RRLGLSCANCHTTTTTLWRRNAEG--EPVCNACGLYMKLHGV-PRPL 491 slkkdgi<-* +kk+gi ee24251 492 AMKKEGI 498 //