hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-04483441/chunk_1/iprscan-20080808-04483441.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef00872 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00096.16.ls Zinc finger, C2H2 type 227.6 2.6e-65 8 PF00096.16.fs Zinc finger, C2H2 type 211.8 1.4e-60 8 PF02023.7.ls SCAN domain 192.9 7.1e-55 1 PF02023.7.fs SCAN domain 190.9 2.7e-54 1 PF01096.9.fs Transcription factor S-II (TFIIS) 30.1 1.3e-08 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02023.7.fs 1/1 63 158 .. 1 96 [] 190.9 2.7e-54 PF02023.7.ls 1/1 63 158 .. 1 96 [] 192.9 7.1e-55 PF00096.16.ls 2/8 301 323 .. 1 24 [] 32.3 1.5e-06 PF00096.16.fs 2/8 301 323 .. 1 24 [] 30.4 2.6e-06 PF00096.16.ls 3/8 329 351 .. 1 24 [] 35.2 2.1e-07 PF00096.16.fs 3/8 329 351 .. 1 24 [] 33.3 4.9e-07 PF00096.16.ls 4/8 357 379 .. 1 24 [] 27.6 4.2e-05 PF00096.16.fs 4/8 357 379 .. 1 24 [] 25.6 3.9e-05 PF00096.16.ls 5/8 385 407 .. 1 24 [] 28.7 1.9e-05 PF00096.16.fs 5/8 385 407 .. 1 24 [] 26.8 2e-05 PF00096.16.ls 6/8 413 435 .. 1 24 [] 31.6 2.5e-06 PF00096.16.fs 6/8 413 435 .. 1 24 [] 29.6 3.9e-06 PF00096.16.ls 7/8 441 463 .. 1 24 [] 31.9 2.1e-06 PF00096.16.fs 7/8 441 463 .. 1 24 [] 29.9 3.3e-06 PF00096.16.ls 8/8 469 491 .. 1 24 [] 33.8 5.5e-07 PF00096.16.fs 8/8 469 491 .. 1 24 [] 31.9 1.1e-06 Alignments of top-scoring domains: PF02023.7.fs: domain 1 of 1, from 63 to 158: score 190.9, E = 2.7e-54 *->pspEifRqrFRqfrYqetsGPrEALsrLReLChqWLrPEvhTKEQIL +++E ++FRq+rY+et GPrEALsrLReLC qWL+PE+hTKEQIL ef00872 63 LGQEPLCKQFRQLRYEETTGPREALSRLRELCQQWLQPETHTKEQIL 109 ELLVLEQFLtILPkElQawVqehhPeSgEEaVtLlEdLerelDepgqqV< ELLVLEQFL ILPkElQa+VqehhPeS E +V +lEdL+ +l+e gqqV ef00872 110 ELLVLEQFLIILPKELQARVQEHHPESREDVVVVLEDLQLDLGETGQQV 158 -* ef00872 - - PF02023.7.ls: domain 1 of 1, from 63 to 158: score 192.9, E = 7.1e-55 *->pspEifRqrFRqfrYqetsGPrEALsrLReLChqWLrPEvhTKEQIL +++E ++FRq+rY+et GPrEALsrLReLC qWL+PE+hTKEQIL ef00872 63 LGQEPLCKQFRQLRYEETTGPREALSRLRELCQQWLQPETHTKEQIL 109 ELLVLEQFLtILPkElQawVqehhPeSgEEaVtLlEdLerelDepgqqV< ELLVLEQFL ILPkElQa+VqehhPeS E +V +lEdL+ +l+e gqqV ef00872 110 ELLVLEQFLIILPKELQARVQEHHPESREDVVVVLEDLQLDLGETGQQV 158 -* ef00872 - - PF00096.16.ls: domain 2 of 8, from 301 to 323: score 32.3, E = 1.5e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+F r+s+L rH+++H ef00872 301 HQCH-ECGKAFQRSSHLVRHQKIH 323 PF00096.16.fs: domain 2 of 8, from 301 to 323: score 30.4, E = 2.6e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+F r+s+L rH+++H ef00872 301 HQCH-ECGKAFQRSSHLVRHQKIH 323 PF00096.16.ls: domain 3 of 8, from 329 to 351: score 35.2, E = 2.1e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs+++ L Hlr+H ef00872 329 YQCN-ECGKVFSQNAGLLEHLRIH 351 PF00096.16.fs: domain 3 of 8, from 329 to 351: score 33.3, E = 4.9e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs+++ L Hlr+H ef00872 329 YQCN-ECGKVFSQNAGLLEHLRIH 351 PF00096.16.ls: domain 4 of 8, from 357 to 379: score 27.6, E = 4.2e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C +Cgk F+r+s+L+rH+r+H ef00872 357 YLCI-HCGKNFRRSSHLNRHQRIH 379 PF00096.16.fs: domain 4 of 8, from 357 to 379: score 25.6, E = 3.9e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C +Cgk F+r+s+L+rH+r+H ef00872 357 YLCI-HCGKNFRRSSHLNRHQRIH 379 PF00096.16.ls: domain 5 of 8, from 385 to 407: score 28.7, E = 1.9e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+Fs+ L++H+r+H ef00872 385 CECK-ECGKTFSQALLLTHHQRIH 407 PF00096.16.fs: domain 5 of 8, from 385 to 407: score 26.8, E = 2e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+Fs+ L++H+r+H ef00872 385 CECK-ECGKTFSQALLLTHHQRIH 407 PF00096.16.ls: domain 6 of 8, from 413 to 435: score 31.6, E = 2.5e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+Fs s+L rH r+H ef00872 413 HQCN-ECGKAFSLTSDLIRHHRIH 435 PF00096.16.fs: domain 6 of 8, from 413 to 435: score 29.6, E = 3.9e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +Cgk+Fs s+L rH r+H ef00872 413 HQCN-ECGKAFSLTSDLIRHHRIH 435 PF00096.16.ls: domain 7 of 8, from 441 to 463: score 31.9, E = 2.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +C+k+F+ +s+L +H r+H ef00872 441 FKCN-ICQKAFRLNSHLAQHVRIH 463 PF00096.16.fs: domain 7 of 8, from 441 to 463: score 29.9, E = 3.3e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +C+k+F+ +s+L +H r+H ef00872 441 FKCN-ICQKAFRLNSHLAQHVRIH 463 PF00096.16.ls: domain 8 of 8, from 469 to 491: score 33.8, E = 5.5e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cg++F+++s L +H+r H ef00872 469 YQCS-ECGEAFRQRSGLFQHQRYH 491 PF00096.16.fs: domain 8 of 8, from 469 to 491: score 31.9, E = 1.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cg++F+++s L +H+r H ef00872 469 YQCS-ECGEAFRQRSGLFQHQRYH 491 //