hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-05032802/chunk_1/iprscan-20080808-05032802.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef00973 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00136 520.0 9.9e-152 1 SM00180 514.8 3.8e-150 10 SM00281 176.9 2e-48 1 SM00181 47.8 1.4e-09 8 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00136 1/1 119 359 .. 1 282 [] 520.0 9.9e-152 SM00180 1/10 361 414 .. 1 42 [] 39.9 3.5e-07 SM00181 1/8 413 455 .. 1 32 [] 1.2 2e+02 SM00180 2/10 417 470 .. 1 42 [] 45.5 7e-09 SM00180 3/10 473 517 .. 1 42 [] 60.1 2.9e-13 SM00181 2/8 474 518 .. 1 32 [] 2.9 1.4e+02 SM00181 3/8 519 568 .. 1 32 [] 1.2 2e+02 SM00180 4/10 520 567 .. 1 42 [] 66.4 3.6e-15 SM00281 1/1 628 753 .. 1 144 [] 176.9 2e-48 SM00181 4/8 795 827 .. 1 32 [] 3.5 1.3e+02 SM00180 5/10 799 845 .. 1 42 [] 57.4 1.8e-12 SM00181 5/8 844 880 .. 1 32 [] 12.8 19 SM00180 6/10 848 900 .. 1 42 [] 36.0 5.1e-06 SM00180 7/10 903 956 .. 1 42 [] 47.1 2.4e-09 SM00181 6/8 916 957 .. 1 32 [] 15.1 10 SM00180 8/10 959 1007 .. 1 42 [] 57.6 1.6e-12 SM00181 7/8 1006 1041 .. 1 32 [] 6.2 72 SM00180 9/10 1010 1055 .. 1 42 [] 56.3 4e-12 SM00181 8/8 1042 1088 .. 1 32 [] 5.1 89 SM00180 10/10 1058 1103 .. 1 42 [] 48.5 8.8e-10 Alignments of top-scoring domains: SM00136: domain 1 of 1, from 119 to 359: score 520.0, E = 9.9e-152 *->agrprrCyPefvNlAfgRkrpvtAtsTCGeqkrprPErYCklvghta +grp+rC+PefvN+Af+ v+At+TCG++ PE+YC+++g ef00973 119 GGRPQRCMPEFVNAAFN--VTVVATNTCGTP----PEEYCVQTG--- 156 etdliWsllekprteqgkkCdlCDarqptkedprrsHpasnltDlnnpnn +t+ +k+C+lCDa+qp +++H+a++ltD+nn+++ ef00973 157 ------------VTGVTKSCHLCDAGQP-----HLQHGAAFLTDYNNQAD 189 ptWWQSeplsnGpqyn.nVnLTLdLgkeFevtYVilkFcPNSPRPeslai +tWWQS+++++G+qy++ +nLTL+Lgk+F++tYV+lkF+ + RPes+ai ef00973 190 TTWWQSQTMLAGVQYPsSINLTLHLGKAFDITYVRLKFH--TSRPESFAI 237 lerStDfGkTWqPwQyySsqdaeCrrtFGrpprgaitkggneqeviCtse ++r+ +++++W+P+QyyS++ C++t+++ +rg+i++gg+eq+++Ct+e ef00973 238 YKRT-REDGPWIPYQYYSGS---CENTYSKANRGFIRTGGDEQQALCTDE 283 ysdisPlegGeiafslLegRPsaedfdnSpvLQewvtATdiRvrltRLnt +sdisPl+gG++afs+LegRPsa++fdnSpvLQewvtATdiRv+l+RLnt ef00973 284 FSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNT 333 plgddlmdvnskeleerDpevtrrYyYaIsDlaVGG<-* +gd++++ Dp+v+++YyYaIsD+aVGG ef00973 334 -FGDEVFN---------DPKVLKSYYYAISDFAVGG 359 SM00180: domain 1 of 10, from 361 to 414: score 39.9, E = 3.5e-07 *->CdCnlpppvG....Cdp....tGqClnCkpnttGGrrCdderCapGy C Cn G+ ++C +++ + +C Ck+nt G C+ +C+p + ef00973 361 CKCN-----GhaseCMKnefdKLVCN-CKHNTYG-VDCE--KCLPFF 398 y.............gC<-* ++++ ++ + ++ ++C ef00973 399 NdrpwrrataesasEC 414 SM00181: domain 1 of 8, from 413 to 455: score 1.2, E = 2e+02 *->eCa..pCsnGgtEqnGtCi...........sytC..CpgpGytg.rC eC++ +C ++C +++ ++++++ +C++C+ + g +C ef00973 413 ECLpcDCNGRS----QECYfdpelyrstghGGHCtnCQ-DNTDGaHC 454 e<-* e ef00973 455 E 455 SM00180: domain 2 of 10, from 417 to 470: score 45.5, E = 7e-09 *->CdCnlpppvG....Cdp..........tGqClnCkpnttGGrrCdde CdCn G++++C+++++ ++++++G+C nC++nt G +C+ ef00973 417 CDCN-----GrsqeCYFdpelyrstghGGHCTNCQDNTDG-AHCE-- 455 rCapGyy......gC<-* rC++++++ ++++ C ef00973 456 RCRENFFrlgnneAC 470 SM00180: domain 3 of 10, from 473 to 517: score 60.1, E = 2.9e-13 *->CdCnlpppvG.....CdptGqClnCkpnttGGrrCdderCapGyy.. C+C+ pvG+ +++Cd+ G+C Ckp+++G ++Cd rC+pG+++ ef00973 473 CHCS---PVGslstqCDSYGRCS-CKPGVMG-DKCD--RCQPGFHsl 512 ...gC<-* ++ gC ef00973 513 teaGC 517 SM00181: domain 2 of 8, from 474 to 518: score 2.9, E = 1.4e+02 *->eCa.......pCsnGgtEqnGtCi......sytC..CpgpGytg... C++ ++ ++ C+ G+C +++ + +C++C+ pG++ ++ ef00973 474 HCSpvgslstQCDSY-----GRCSckpgvmGDKCdrCQ-PGFHSlte 514 .rCe<-* C ef00973 515 aGCR 518 SM00181: domain 3 of 8, from 519 to 568: score 1.2, E = 2e+02 *->eCa........pCsnGgtEqnGtCi......sytC..CpgpGytg.. +C+ +++++ + C G+C+ +++ +++ C++C+ pG+ + ef00973 519 PCScdpsgsidECNVET----GRCVckdnveGFNCerCK-PGFFNle 560 .....rCe<-* +++++ C ef00973 561 ssnprGCT 568 SM00180: domain 4 of 10, from 520 to 567: score 66.4, E = 3.6e-15 *->CdCnlpppvG....Cdp.tGqClnCkpnttGGrrCdderCapGyy.. C C+ p+G+ ++C+ +tG+C+ Ck+n++G +C+ rC+pG+++ ef00973 520 CSCD---PSGsideCNVeTGRCV-CKDNVEG-FNCE--RCKPGFFnl 559 ......gC<-* ++++++gC ef00973 560 essnprGC 567 SM00281: domain 1 of 1, from 628 to 753: score 176.9, E = 2e-48 *->daepvYWkaPeqFLQGDkvtSYGGkLkYtlsyegregevdgntlsrq ++ p Y+ aP++FL G++v SYG++L++++++++r ++ls+ ef00973 628 SYFPRYFIAPAKFL-GKQVLSYGQNLSFSFRVDRR-----DTRLSA- 667 DvpDViLeGndngirlshralvaqgpplPdeettvevrfrEenwqyfgss D +LeG+ g+r+s++ l+aqg+++P+e t ++ fr+++ +++ ef00973 668 --EDLVLEGA--GLRVSVP-LIAQGNSYPSETTV-KYVFRLHEATDYP-- 709 gqPvtReelFmmvLadLdailIRATyYseqqlasyrLsdVsLevAvp<-* ++P+ ++F+++L++L+ i+IR+T Yse++++ +L+dV+L +A+p ef00973 710 WRPALTPFEFQKLLNNLTSIKIRGT-YSERSAG--YLDDVTLASARP 753 SM00181: domain 4 of 8, from 795 to 827: score 3.5, E = 1.3e+02 *->eCa..pCsnGgtEqnGtCi..sytC.CpgpGytg.rCe<-* +C C + tC +++ C+C+ + g++Ce ef00973 795 PCVlcACNGHS----ETCDpeTGVCnCR-DNTAGpHCE 827 SM00180: domain 5 of 10, from 799 to 845: score 57.4, E = 1.8e-12 *->CdCnlpppvG....Cdp.tGqClnCkpnttGGrrCdderCapGyy.. C Cn G++++Cdp+tG+C C++nt+G ++C+ +C +Gyy++ ef00973 799 CACN-----GhsetCDPeTGVCN-CRDNTAG-PHCE--KCSDGYYgd 836 .......gC<-* ++ +++++C ef00973 837 stagtssDC 845 SM00181: domain 5 of 8, from 844 to 880: score 12.8, E = 19 *->eCa..pCsnGgtEqnGtCi......sytC..CpgpGytg.rCe<-* +C++ pC G C ++++ C++Cp G tg+rCe ef00973 844 DCQpcPCPGGS-----SCAvvpktkEVVCtnCP-TGTTGkRCE 880 SM00180: domain 6 of 10, from 848 to 900: score 36.0, E = 5.1e-06 *->CdCnlpppvG...Cdp.....tGqClnCkpnttGGrrCdderCapGy C+C+ G+++C ++++ +C nC +ttG rC+ C +Gy ef00973 848 CPCP-----GgssCAVvpktkEVVCTNCPTGTTG-KRCE--LCDDGY 886 y...........gC<-* ++++ +++++ + C ef00973 887 FgdplgrngpvrLC 900 SM00180: domain 7 of 10, from 903 to 956: score 47.1, E = 2.4e-09 *->CdCnl.pppvG...Cdp.tGqClnCkpnttGGrrCdderCapGyy.. C+C+++++p ++C++ tG Cl+C nt+G Cd rC++G++++ ef00973 903 CQCSDnIDPNAvgnCNRlTGECLKCIYNTAG-FYCD--RCKDGFFgn 946 ........gC<-* + +++ + C ef00973 947 plapnpadKC 956 SM00181: domain 6 of 8, from 916 to 957: score 15.1, E = 10 *->eCa....pCsnGgtEqnGtCi....sytC..CpgpGytg........ C + ++ C +Ci ++ +++C++C+ +G+ g++ +++ ef00973 916 NCNrltgECL--------KCIyntaGFYCdrCK-DGFFGnplapnpa 953 .rCe<-* + C+ ef00973 954 dKCK 957 SM00180: domain 8 of 10, from 959 to 1007: score 57.6, E = 1.6e-12 *->CdCnlpppvG.......Cdp.tGqClnCkpnttGGrrCdderCapGy C+Cn p G+ +++++C+p tGqC+ C p++tG + C C pG+ ef00973 959 CNCN---PYGtmkqqssCNPvTGQCE-CLPHVTG-QDCG--ACDPGF 998 y......gC<-* y+ ++++gC ef00973 999 YnlqsgqGC 1007 SM00181: domain 7 of 8, from 1006 to 1041: score 6.2, E = 72 *->eCa..pCsnGgtEqnGtCi..sytC.CpgpGytg.rCe<-* C++ +C+ g+ nG+C ++ +C+C+ pG tg++Ce ef00973 1006 GCErcDCHALGS-TNGQCDirTGQCeCQ-PGITGqHCE 1041 SM00180: domain 9 of 10, from 1010 to 1055: score 56.3, E = 4e-12 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. CdC+ + G+++++Cd +tGqC+ C+p+ tG ++C+ rC+ ++++ ef00973 1010 CDCH---ALGstngqCDIrTGQCE-CQPGITG-QHCE--RCEVNHFg 1049 ....gC<-* +++gC ef00973 1050 fgpeGC 1055 SM00181: domain 8 of 8, from 1042 to 1088: score 5.1, E = 89 *->eCa............pCsnGgtEqnGtCi...........sytC.Cp C+ ++ + ++++ +pC+ C+++++ + ++ +C+C+ ef00973 1042 RCEvnhfgfgpegckPCD---------CHpegslslqckdDGRCeCR 1079 gpGytg.rCe<-* +G+ g+rC ef00973 1080 -EGFVGnRCD 1088 SM00180: domain 10 of 10, from 1058 to 1103: score 48.5, E = 8.8e-10 *->CdCnlpppvG.....CdptGqClnCkpnttGGrrCdderCapGyy.. CdC+ p G+ + +C +G+C+ C+++ +G rCd +C+++y+ + ef00973 1058 CDCH---PEGslslqCKDDGRCE-CREGFVG-NRCD--QCEENYFyn 1097 ....gC<-* ++ +gC ef00973 1098 rswpGC 1103 //