hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-06213916/chunk_1/iprscan-20080808-06213916.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef01524 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00317 140.7 1.5e-37 1 SM00570 115.3 7.1e-30 1 SM00456 53.2 3.4e-11 1 SM00508 34.2 1.8e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00570 1/1 1497 1552 .. 1 62 [] 115.3 7.1e-30 SM00317 1/1 1553 1754 .. 1 114 [] 140.7 1.5e-37 SM00508 1/1 1755 1771 .. 1 17 [] 34.2 1.8e-05 SM00456 1/1 2471 2503 .. 1 34 [] 53.2 3.4e-11 Alignments of top-scoring domains: SM00570: domain 1 of 1, from 1497 to 1552: score 115.3, E = 7.1e-30 *->ndimtCeCkplddDgelkGegaCgedsdClNRmmElliECsDpssCp +++m+CeC+pl++D+ ++Ge+aCg +dClNR+ l+iECs s+Cp ef01524 1497 IKRMQCECTPLSKDERAQGEIACG--EDCLNRL--LMIECS--SRCP 1537 cGsyCsNQrFQkrqy<-* +G+yCsN+rFQ++q+ ef01524 1538 NGDYCSNRRFQRKQH 1552 SM00317: domain 1 of 1, from 1553 to 1754: score 140.7, E = 1.5e-37 *->aklevfkskgkGwGlratedIpkGefIleyvGeii............ a++ev +++kGwGlra++d+p ++f+ley+Ge++++++ + + ++ ef01524 1553 ADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLdhkefkarvkey 1599 .................................................. ++++ + +++++++++ + + + ++ ++ ++ +++ ++ + + ef01524 1600 arnknihyyfmalkndetesrsiaqagvqwqdlgslqplppgfkrfscls 1649 ......................................fylfd..ciDat ++ + ++++++ + ++++ +++ ++ +++++ + + + + iDat ef01524 1650 flsswdyrrppprlanfcifsrdgvsprwpgwsrspdlTKALRlqIIDAT 1699 ranggkGniarfiNHSCePNcelifvevdgfdprgasdsadprivifAlr + kGn++rf+NHSCePNce++++ v+g r+++f+++ ef01524 1700 Q----KGNCSRFMNHSCEPNCETQKWTVNG----------QLRVGFFTTK 1735 dIkpGEELtidYgddyege<-* ++ G ELt+dY++ ++g+ ef01524 1736 LVPSGSELTFDYQFQRYGK 1754 SM00508: domain 1 of 1, from 1755 to 1771: score 34.2, E = 1.8e-05 *->kkqpClCGaanCrGfLg<-* ++q+C+CG+anCrG+Lg ef01524 1755 EAQKCFCGSANCRGYLG 1771 SM00456: domain 1 of 1, from 2471 to 2503: score 53.2, E = 3.4e-11 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* lPp+W+ + dp+ G++YYy+++T++tqW++P++ ef01524 2471 VLPPNWKTARDPE-GKIYYYHVITRQTQWDPPTW 2503 //