hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-04432402/chunk_1/iprscan-20090618-04432402.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef03452 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00170.11.fs bZIP transcription factor 62.3 4.8e-17 1 PF00170.11.ls bZIP transcription factor 64.3 3.7e-16 1 PF07716.5.fs Basic region leucine zipper 38.6 1.4e-09 1 PF07716.5.ls Basic region leucine zipper 40.6 5e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00170.11.fs 1/1 301 365 .. 1 65 [] 62.3 4.8e-17 PF07716.5.fs 1/1 301 355 .. 1 57 [] 38.6 1.4e-09 PF00170.11.ls 1/1 301 365 .. 1 65 [] 64.3 3.7e-16 PF07716.5.ls 1/1 301 355 .. 1 57 [] 40.6 5e-09 Alignments of top-scoring domains: PF00170.11.fs: domain 1 of 1, from 301 to 365: score 62.3, E = 4.8e-17 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk ek+lK+ rRk+kN+++A++sR++K+++++ Le kve+ ++eN +Lrk ef03452 301 EKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRK 347 elerLkkevakLksenee<-* ++e L++++ L++++ + ef03452 348 KVEVLENTNRTLLQQLQK 365 PF07716.5.fs: domain 1 of 1, from 301 to 355: score 38.6, E = 1.4e-09 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk +++ ++ rR+++N ++A+ sR KkK++++ le++v+ eN +L ef03452 301 EKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLEL-- 345 rqkveqLekE<-* r kve Le+ ef03452 346 RKKVEVLENT 355 PF00170.11.ls: domain 1 of 1, from 301 to 365: score 64.3, E = 3.7e-16 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk ek+lK+ rRk+kN+++A++sR++K+++++ Le kve+ ++eN +Lrk ef03452 301 EKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRK 347 elerLkkevakLksenee<-* ++e L++++ L++++ + ef03452 348 KVEVLENTNRTLLQQLQK 365 PF07716.5.ls: domain 1 of 1, from 301 to 355: score 40.6, E = 5e-09 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk +++ ++ rR+++N ++A+ sR KkK++++ le++v+ eN +L ef03452 301 EKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLEL-- 345 rqkveqLekE<-* r kve Le+ ef03452 346 RKKVEVLENT 355 //