hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-04432402/chunk_1/iprscan-20090618-04432402.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ef03452
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00338                                                  67.7    1.4e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00338    1/1     301   365 ..     1    65 []    67.7  1.4e-15

Alignments of top-scoring domains:
SM00338: domain 1 of 1, from 301 to 365: score 67.7, E = 1.4e-15
                   *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk
                      ek +K++rR+++N+++A+ sR++Kk+y++ Le+kve  + EN +Lrk
     ef03452   301    EKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRK 347  

                   eleqLrreleklkselee<-*
                   ++e L++ +++l ++l++   
     ef03452   348 KVEVLENTNRTLLQQLQK    365  

//