hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-08332798/chunk_1/iprscan-20080808-08332798.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef03457 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07645.6.ls Calcium binding EGF domain 685.0 5.3e-203 17 PF07645.6.fs Calcium binding EGF domain 661.2 3.3e-200 19 PF00008.17.ls EGF-like domain 322.2 8.3e-94 17 PF00008.17.fs EGF-like domain 310.2 3.5e-90 18 PF00683.8.fs TB domain 190.9 2e-59 4 PF00683.8.ls TB domain 195.4 1.3e-55 4 PF07974.3.fs EGF-like domain 100.6 4.4e-27 12 PF07974.3.ls EGF-like domain 91.7 2e-24 11 PF01826.8.fs Trypsin Inhibitor like cysteine rich domain 73.2 6.1e-23 16 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07974.3.fs 1/12 70 97 .. 1 37 [] 29.4 3.3e-07 PF00008.17.ls 1/17 70 97 .. 1 38 [] 21.1 0.0037 PF07974.3.ls 1/11 70 97 .. 1 37 [] 31.0 3.8e-06 PF00683.8.fs 1/4 440 475 .. 1 38 [. 24.1 6.5e-07 PF00683.8.ls 1/4 440 485 .. 1 45 [] 22.7 5e-05 PF07645.6.ls 1/17 501 540 .. 1 55 [] 38.7 1.8e-08 PF07645.6.fs 3/19 501 540 .. 1 55 [] 37.0 1.8e-10 PF00008.17.ls 3/17 505 540 .. 1 38 [] 19.7 0.0099 PF00683.8.ls 2/4 560 602 .. 1 45 [] 69.6 9.2e-18 PF00683.8.fs 2/4 560 602 .. 1 45 [] 67.7 1.3e-20 PF00008.17.ls 4/17 727 764 .. 1 38 [] 25.0 0.00025 PF07645.6.fs 5/19 766 807 .. 1 55 [] 23.8 1.9e-06 PF07645.6.ls 3/17 766 807 .. 1 55 [] 25.5 0.00017 PF00008.17.ls 5/17 770 807 .. 1 38 [] 26.8 7.3e-05 PF00008.17.fs 5/18 770 804 .. 1 37 [. 29.8 1.9e-07 PF07645.6.fs 6/19 809 839 .. 1 41 [. 39.0 4.4e-11 PF07645.6.ls 4/17 809 847 .. 1 55 [] 40.6 4.9e-09 PF07645.6.ls 5/17 849 887 .. 1 55 [] 46.1 1.1e-10 PF07645.6.fs 7/19 849 887 .. 1 55 [] 44.4 1e-12 PF07645.6.ls 6/17 889 928 .. 1 55 [] 53.9 5.1e-13 PF07645.6.fs 8/19 889 928 .. 1 55 [] 52.1 4.5e-15 PF00008.17.ls 7/17 893 928 .. 1 38 [] 22.5 0.0014 PF07645.6.ls 7/17 930 970 .. 1 55 [] 64.5 3.1e-16 PF07645.6.fs 9/19 930 970 .. 1 55 [] 62.8 2.6e-18 PF07645.6.ls 8/17 972 1012 .. 1 55 [] 60.0 7e-15 PF07645.6.fs 10/19 972 1012 .. 1 55 [] 58.3 6e-17 PF07645.6.ls 9/17 1014 1053 .. 1 55 [] 56.2 9.8e-14 PF07645.6.fs 11/19 1014 1053 .. 1 55 [] 54.5 8.5e-16 PF00008.17.fs 10/18 1018 1053 .. 1 38 [] 24.0 8e-06 PF00008.17.ls 9/17 1018 1053 .. 1 38 [] 26.0 0.00013 PF07645.6.ls 10/17 1055 1095 .. 1 55 [] 36.6 7.9e-08 PF07645.6.fs 12/19 1055 1095 .. 1 55 [] 34.9 7.9e-10 PF07645.6.ls 11/17 1097 1136 .. 1 55 [] 57.0 5.6e-14 PF07645.6.fs 13/19 1097 1136 .. 1 55 [] 55.3 4.9e-16 PF07645.6.ls 12/17 1138 1180 .. 1 55 [] 32.1 1.7e-06 PF07645.6.fs 14/19 1138 1180 .. 1 55 [] 30.4 1.8e-08 PF07645.6.fs 15/19 1182 1222 .. 1 55 [] 40.8 1.3e-11 PF07645.6.ls 13/17 1182 1222 .. 1 55 [] 42.5 1.3e-09 PF07645.6.ls 14/17 1224 1265 .. 1 55 [] 32.0 2e-06 PF07645.6.fs 16/19 1224 1265 .. 1 55 [] 30.2 2.1e-08 PF00683.8.ls 3/4 1300 1341 .. 1 45 [] 52.4 1.4e-12 PF00683.8.fs 3/4 1300 1341 .. 1 45 [] 50.5 3.3e-15 PF07645.6.ls 15/17 1364 1405 .. 1 55 [] 25.3 0.00021 PF00008.17.ls 14/17 1368 1405 .. 1 38 [] 20.2 0.007 PF00008.17.fs 16/18 1411 1445 .. 1 38 [] 30.1 1.6e-07 PF00008.17.ls 15/17 1411 1445 .. 1 38 [] 32.0 1.9e-06 PF00683.8.ls 4/4 1472 1514 .. 1 45 [] 50.6 4.8e-12 PF00683.8.fs 4/4 1472 1514 .. 1 45 [] 48.7 1.2e-14 PF00008.17.ls 16/17 1616 1651 .. 1 38 [] 24.1 0.00047 PF07645.6.fs 19/19 1653 1696 .. 1 55 [] 31.2 1e-08 PF07645.6.ls 17/17 1653 1696 .. 1 55 [] 32.9 1e-06 PF00008.17.ls 17/17 1657 1696 .. 1 38 [] 20.7 0.0049 Alignments of top-scoring domains: PF07974.3.fs: domain 1 of 12, from 70 to 97: score 29.4, E = 3.3e-07 *->C...CngshGtCvspngtstpcgkCvCdsgyedkyqGadC<-* C+++C++ +G C +p+ CvC sg + Ga C ef03457 70 CeppCQN-RGSCSRPQL-------CVCRSG----FRGARC 97 PF00008.17.ls: domain 1 of 17, from 70 to 97: score 21.1, E = 0.0037 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C p pC+n+G C + + C C G + G rC ef03457 70 CEP---PCQNRGSCSRPQ---LCVCRSG----FRGARC 97 PF07974.3.ls: domain 1 of 11, from 70 to 97: score 31.0, E = 3.8e-06 *->C...CngshGtCvspngtstpcgkCvCdsgyedkyqGadC<-* C+++C++ +G C +p+ CvC sg + Ga C ef03457 70 CeppCQN-RGSCSRPQL-------CVCRSG----FRGARC 97 PF00683.8.fs: domain 1 of 4, from 440 to 475: score 24.1, E = 6.5e-07 *->grCsnplpgravTKseCCCsvGrgeAWGtp.CElCPvpg<-* g+C npl +T CC svG+ WG C +CP+++ ef03457 440 GQCANPLLE-LTTQEDCCGSVGA--FWGVTlCAPCPPRP 475 PF00683.8.ls: domain 1 of 4, from 440 to 485: score 22.7, E = 5e-05 *->grCsnplpgravTKseCCCsvGrgeAWGtp.CElCPvpgta...efk g+C npl +T CC svG+ WG C +CP+++ + e + ef03457 440 GQCANPLLE-LTTQEDCCGSVGA--FWGVTlCAPCPPRPASpviENG 483 eL<-* +L ef03457 484 QL 485 PF07645.6.ls: domain 1 of 17, from 501 to 540: score 38.7, E = 1.8e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + + C ++++CvNt GS+ C+ C++G ef03457 501 DINECLTLG--LC----KDAECVNTRGSYLCT----CRPGLM----- 532 nnedgtnC<-* + + C ef03457 533 LDPSRSRC 540 PF07645.6.fs: domain 3 of 19, from 501 to 540: score 37.0, E = 1.8e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + + C ++++CvNt GS+ C+ C++G ef03457 501 DINECLTLG--LC----KDAECVNTRGSYLCT----CRPGLM----- 532 nnedgtnC<-* + + C ef03457 533 LDPSRSRC 540 PF00008.17.ls: domain 3 of 17, from 505 to 540: score 19.7, E = 0.0099 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C C+ ++Cv+t+g+y C C pG+ l+ + rC ef03457 505 CLTLG-LCKD-AECVNTRGSYLCTCRPGLMLDPSRSRC 540 PF00683.8.ls: domain 2 of 4, from 560 to 602: score 69.6, E = 9.2e-18 *->grCsnplpgravTKseCCCs.vGrgeAWGtpCElCPvpgtaefkeL< g+C pl++r +TK+ CCCs+vG+ AWG++CE+CP+pgt++f+e+ ef03457 560 GTCTLPLAQR-ITKQICCCSrVGK--AWGSECEKCPLPGTEAFREI 602 -* ef03457 - - PF00683.8.fs: domain 2 of 4, from 560 to 602: score 67.7, E = 1.3e-20 *->grCsnplpgravTKseCCCs.vGrgeAWGtpCElCPvpgtaefkeL< g+C pl++r +TK+ CCCs+vG+ AWG++CE+CP+pgt++f+e+ ef03457 560 GTCTLPLAQR-ITKQICCCSrVGK--AWGSECEKCPLPGTEAFREI 602 -* ef03457 - - PF00008.17.ls: domain 4 of 17, from 727 to 764: score 25.0, E = 0.00025 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ ++ C GtCv++p+gy+C C pGy+l+ ++ +C ef03457 727 CAAGAtNVCGP-GTCVNLPDGYRCVCSPGYQLHPSQAYC 764 PF07645.6.fs: domain 5 of 19, from 766 to 807: score 23.8, E = 1.9e-06 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + C ++ C+N +GS++C C +GY+ ef03457 766 DDNECLR---DPC---KGKGRCINRVGSYSCF----CYPGYT---LA 799 nnedgtnC<-* + + +C ef03457 800 TSGATQEC 807 PF07645.6.ls: domain 3 of 17, from 766 to 807: score 25.5, E = 0.00017 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + C ++ C+N +GS++C C +GY+ ef03457 766 DDNECLR---DPC---KGKGRCINRVGSYSCF----CYPGYT---LA 799 nnedgtnC<-* + + +C ef03457 800 TSGATQEC 807 PF00008.17.ls: domain 5 of 17, from 770 to 807: score 26.8, E = 7.3e-05 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkr..C<-* C + pC++ G+C++ g+y+C+C pGy l+ +G +++C ef03457 770 CLRD--PCKGKGRCINRVGSYSCFCYPGYTLATSGATqeC 807 PF00008.17.fs: domain 5 of 18, from 770 to 804: score 29.8, E = 1.9e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkr<-* C + pC++ G+C++ g+y+C+C pGy l+ +G + ef03457 770 CLRD--PCKGKGRCINRVGSYSCFCYPGYTLATSGAT 804 PF07645.6.fs: domain 6 of 19, from 809 to 839: score 39.0, E = 4.4e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGY<-* D++EC++++ +C ++ C+Nt+GS+ C+ C++GY ef03457 809 DINECEQPG--VC----SGGQCTNTEGSYHCE----CDQGY 839 PF07645.6.ls: domain 4 of 17, from 809 to 847: score 40.6, E = 4.9e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC++++ +C ++ C+Nt+GS+ C+ C++GY ef03457 809 DINECEQPG--VC----SGGQCTNTEGSYHCE----CDQGYI----- 840 nnedgtnC<-* ++C ef03457 841 -MVRKGHC 847 PF07645.6.ls: domain 5 of 17, from 849 to 887: score 46.1, E = 1.1e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ ++ C+ ++ CvN GS++C+ +C+eGY+ ef03457 849 DINECRHPG--TCP----DGRCVNSPGSYTCL---ACEEGYR----- 881 nnedgtnC<-* + ++ C ef03457 882 --GQSGSC 887 PF07645.6.fs: domain 7 of 19, from 849 to 887: score 44.4, E = 1e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ ++ C+ ++ CvN GS++C+ +C+eGY+ ef03457 849 DINECRHPG--TCP----DGRCVNSPGSYTCL---ACEEGYR----- 881 nnedgtnC<-* + ++ C ef03457 882 --GQSGSC 887 PF07645.6.ls: domain 6 of 17, from 889 to 928: score 53.9, E = 5.1e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC +++ +C a ++C+N +GSF+C+ C++GYe ef03457 889 DVNECLTPG--VC----AHGKCTNLEGSFRCS----CEQGYE----- 920 nnedgtnC<-* + d++ C ef03457 921 VTSDEKGC 928 PF07645.6.fs: domain 8 of 19, from 889 to 928: score 52.1, E = 4.5e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC +++ +C a ++C+N +GSF+C+ C++GYe ef03457 889 DVNECLTPG--VC----AHGKCTNLEGSFRCS----CEQGYE----- 920 nnedgtnC<-* + d++ C ef03457 921 VTSDEKGC 928 PF00008.17.ls: domain 7 of 17, from 893 to 928: score 22.5, E = 0.0014 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C C + G+C++++g+++C C +Gy + + k C ef03457 893 CLTPG-VCAH-GKCTNLEGSFRCSCEQGYEVTSDEKGC 928 PF07645.6.ls: domain 7 of 17, from 930 to 970: score 64.5, E = 3.1e-16 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+ + ++C+ ++ C+Nt+GSF C+ +C+ GY+ ef03457 930 DVDECAS-R-ASCP----TGLCLNTEGSFACS---ACENGYW----- 962 nnedgtnC<-* +nedgt+C ef03457 963 VNEDGTAC 970 PF07645.6.fs: domain 9 of 19, from 930 to 970: score 62.8, E = 2.6e-18 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+ + ++C+ ++ C+Nt+GSF C+ +C+ GY+ ef03457 930 DVDECAS-R-ASCP----TGLCLNTEGSFACS---ACENGYW----- 962 nnedgtnC<-* +nedgt+C ef03457 963 VNEDGTAC 970 PF07645.6.ls: domain 8 of 17, from 972 to 1012: score 60.0, E = 7e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DECa+++ +C+ ++vC+Nt GSF+C dC+ GY+ ef03457 972 DLDECAFPG--VCP----SGVCTNTAGSFSCK---DCDGGYR----- 1004 nnedgtnC<-* + + g+ C ef03457 1005 PSPLGDSC 1012 PF07645.6.fs: domain 10 of 19, from 972 to 1012: score 58.3, E = 6e-17 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DECa+++ +C+ ++vC+Nt GSF+C dC+ GY+ ef03457 972 DLDECAFPG--VCP----SGVCTNTAGSFSCK---DCDGGYR----- 1004 nnedgtnC<-* + + g+ C ef03457 1005 PSPLGDSC 1012 PF07645.6.ls: domain 9 of 17, from 1014 to 1053: score 56.2, E = 9.8e-14 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC+d++ +C +++C Nt+GS++C+ Cp+G++ ef03457 1014 DVDECEDPQ-SSC----LGGECKNTVGSYQCL----CPQGFQ----- 1046 nnedgtnC<-* ++gt+C ef03457 1047 -LANGTVC 1053 PF07645.6.fs: domain 11 of 19, from 1014 to 1053: score 54.5, E = 8.5e-16 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC+d++ +C +++C Nt+GS++C+ Cp+G++ ef03457 1014 DVDECEDPQ-SSC----LGGECKNTVGSYQCL----CPQGFQ----- 1046 nnedgtnC<-* ++gt+C ef03457 1047 -LANGTVC 1053 PF00008.17.fs: domain 10 of 18, from 1018 to 1053: score 24.0, E = 8e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C + C++ G+C +t g+y+C Cp+G f l +G C ef03457 1018 CEDPQSSCLG-GECKNTVGSYQCLCPQG-FQLANGTVC 1053 PF00008.17.ls: domain 9 of 17, from 1018 to 1053: score 26.0, E = 0.00013 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C + C++ G+C +t g+y+C Cp+G f l +G C ef03457 1018 CEDPQSSCLG-GECKNTVGSYQCLCPQG-FQLANGTVC 1053 PF07645.6.ls: domain 10 of 17, from 1055 to 1095: score 36.6, E = 7.9e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC + +C + ++C+N GSF C+ C +G+ ef03457 1055 DVNECMGEE--HC---APHGECLNSHGSFFCL----CAPGFV----- 1087 nnedgtnC<-* e+gt C ef03457 1088 SAEGGTSC 1095 PF07645.6.fs: domain 12 of 19, from 1055 to 1095: score 34.9, E = 7.9e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC + +C + ++C+N GSF C+ C +G+ ef03457 1055 DVNECMGEE--HC---APHGECLNSHGSFFCL----CAPGFV----- 1087 nnedgtnC<-* e+gt C ef03457 1088 SAEGGTSC 1095 PF07645.6.ls: domain 11 of 17, from 1097 to 1136: score 57.0, E = 5.6e-14 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+ t + C +++CvNt+GSF+C+ C+ G++ ef03457 1097 DVDECAT-T-DPC----VGGHCVNTEGSFNCL----CETGFQ----- 1128 nnedgtnC<-* + +++++C ef03457 1129 PSPESGEC 1136 PF07645.6.fs: domain 13 of 19, from 1097 to 1136: score 55.3, E = 4.9e-16 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+ t + C +++CvNt+GSF+C+ C+ G++ ef03457 1097 DVDECAT-T-DPC----VGGHCVNTEGSFNCL----CETGFQ----- 1128 nnedgtnC<-* + +++++C ef03457 1129 PSPESGEC 1136 PF07645.6.ls: domain 12 of 17, from 1138 to 1180: score 32.1, E = 1.7e-06 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC+d++ +C+ + +C+N GS++Cv C +G+ ef03457 1138 DIDECEDYGDPVCG----TWKCENSPGSYRCV--LGCQPGFH----- 1173 nnedgtnC<-* ++++ C ef03457 1174 -MAPNGDC 1180 PF07645.6.fs: domain 14 of 19, from 1138 to 1180: score 30.4, E = 1.8e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC+d++ +C+ + +C+N GS++Cv C +G+ ef03457 1138 DIDECEDYGDPVCG----TWKCENSPGSYRCV--LGCQPGFH----- 1173 nnedgtnC<-* ++++ C ef03457 1174 -MAPNGDC 1180 PF07645.6.fs: domain 15 of 19, from 1182 to 1222: score 40.8, E = 1.3e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DECa+ t +C+ + C Nt+GSF+C+ C++G+e ef03457 1182 DIDECANDT--MCG---SHGFCDNTDGSFRCL----CDQGFE----- 1214 nnedgtnC<-* + g C ef03457 1215 ISPSGWDC 1222 PF07645.6.ls: domain 13 of 17, from 1182 to 1222: score 42.5, E = 1.3e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DECa+ t +C+ + C Nt+GSF+C+ C++G+e ef03457 1182 DIDECANDT--MCG---SHGFCDNTDGSFRCL----CDQGFE----- 1214 nnedgtnC<-* + g C ef03457 1215 ISPSGWDC 1222 PF07645.6.ls: domain 14 of 17, from 1224 to 1265: score 32.0, E = 2e-06 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC+ ++C+ ++ C+N +GSF C+ C + e e ef03457 1224 DVNECELML-AVCG----AALCENVEGSFLCL----CASDLE----E 1257 nnedgtnC<-* + +++C ef03457 1258 YDAQEGHC 1265 PF07645.6.fs: domain 16 of 19, from 1224 to 1265: score 30.2, E = 2.1e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC+ ++C+ ++ C+N +GSF C+ C + e e ef03457 1224 DVNECELML-AVCG----AALCENVEGSFLCL----CASDLE----E 1257 nnedgtnC<-* + +++C ef03457 1258 YDAQEGHC 1265 PF00683.8.ls: domain 3 of 4, from 1300 to 1341: score 52.4, E = 1.4e-12 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- Cs l+ + +T +eCCC+ G+ WG+ C lCP +++aef e+ ef03457 1300 APCSSVLGRN-TTQAECCCTQGA--SWGDACDLCPSEDSAEFSEI 1341 * ef03457 - - PF00683.8.fs: domain 3 of 4, from 1300 to 1341: score 50.5, E = 3.3e-15 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- Cs l+ + +T +eCCC+ G+ WG+ C lCP +++aef e+ ef03457 1300 APCSSVLGRN-TTQAECCCTQGA--SWGDACDLCPSEDSAEFSEI 1341 * ef03457 - - PF07645.6.ls: domain 15 of 17, from 1364 to 1405: score 25.3, E = 0.00021 *->DvDECad.gtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvs D DEC + g+ C+ n+ C+Nt+ ++ C+ C +G+ ef03457 1364 DADECVIfGP-GLCP----NGRCLNTVPGYVCL----CNPGFH---- 1397 ennedgtnC<-* + ++C ef03457 1398 -YDASHKKC 1405 PF00008.17.ls: domain 14 of 17, from 1368 to 1405: score 20.2, E = 0.007 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C +g C n G+C++t +gy C C pG++++ + k+C ef03457 1368 CVIFGpGLCPN-GRCLNTVPGYVCLCNPGFHYDASHKKC 1405 PF00008.17.fs: domain 16 of 18, from 1411 to 1445: score 30.1, E = 1.6e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ C n G+Cv+t+g+++C+C p++ l+ ++ rC ef03457 1411 CQDL--ACEN-GECVNTEGSFHCFCSPPLTLDLSQQRC 1445 PF00008.17.ls: domain 15 of 17, from 1411 to 1445: score 32.0, E = 1.9e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ C n G+Cv+t+g+++C+C p++ l+ ++ rC ef03457 1411 CQDL--ACEN-GECVNTEGSFHCFCSPPLTLDLSQQRC 1445 PF00683.8.ls: domain 4 of 4, from 1472 to 1514: score 50.6, E = 4.8e-12 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- +Cs pl g+ +T++eCCC G+ AW +C lCP++ ++ +++L ef03457 1472 DVCSEPLRGHRTTYTECCCQDGE--AWSQQCALCPPRSSEVYAQL 1514 * ef03457 - - PF00683.8.fs: domain 4 of 4, from 1472 to 1514: score 48.7, E = 1.2e-14 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- +Cs pl g+ +T++eCCC G+ AW +C lCP++ ++ +++L ef03457 1472 DVCSEPLRGHRTTYTECCCQDGE--AWSQQCALCPPRSSEVYAQL 1514 * ef03457 - - PF00008.17.ls: domain 16 of 17, from 1616 to 1651: score 24.1, E = 0.00047 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C n +C n G+Cv++++gytC+C +G++l+ + C ef03457 1616 CGILN-GCEN-GRCVRVREGYTCDCFEGFQLDAAHMAC 1651 PF07645.6.fs: domain 19 of 19, from 1653 to 1696: score 31.2, E = 1e-08 *->DvDECad..gtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpv Dv+EC+d +g+ C + C+Nt+GS++C C++GY ef03457 1653 DVNECDDlnGPAVLC----VHGYCENTEGSYRCH----CSPGYV--- 1688 sennedgtnC<-* + +++ +C ef03457 1689 --AEAGPPHC 1696 PF07645.6.ls: domain 17 of 17, from 1653 to 1696: score 32.9, E = 1e-06 *->DvDECad..gtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpv Dv+EC+d +g+ C + C+Nt+GS++C C++GY ef03457 1653 DVNECDDlnGPAVLC----VHGYCENTEGSYRCH----CSPGYV--- 1688 sennedgtnC<-* + +++ +C ef03457 1689 --AEAGPPHC 1696 PF00008.17.ls: domain 17 of 17, from 1657 to 1696: score 20.7, E = 0.0049 *->Cspnn...gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n++ + C + G C +t+g+y+C+C pGy+ + ++C ef03457 1657 CDDLNgpaVLCVH-GYCENTEGSYRCHCSPGYVAEAGPPHC 1696 //