hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-08403171/chunk_1/iprscan-20080808-08403171.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef03603 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00014.13.fs Kunitz/Bovine pancreatic trypsin inhibito 190.4 6.5e-66 2 PF00014.13.ls Kunitz/Bovine pancreatic trypsin inhibito 194.4 2.5e-55 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00014.13.fs 1/2 64 116 .. 1 54 [] 92.5 8.1e-32 PF00014.13.ls 1/2 64 116 .. 1 54 [] 94.5 2.9e-25 PF00014.13.fs 2/2 135 187 .. 1 54 [] 97.9 1.1e-33 PF00014.13.ls 2/2 135 187 .. 1 54 [] 99.9 7.1e-27 Alignments of top-scoring domains: PF00014.13.fs: domain 1 of 2, from 64 to 116: score 92.5, E = 8.1e-32 *->iCslPpdsGpCkgsilpRyyYnpstgqCepFiYgGCgGNaNNFetle +C +d GpCk+ + +R+++n t+qCe+FiYgGC+GN+N+Fe+le ef03603 64 FCAFKADDGPCKAIM-KRFFFNIFTRQCEEFIYGGCEGNQNRFESLE 109 eCertCg<-* eC+++C ef03603 110 ECKKMCT 116 PF00014.13.ls: domain 1 of 2, from 64 to 116: score 94.5, E = 2.9e-25 *->iCslPpdsGpCkgsilpRyyYnpstgqCepFiYgGCgGNaNNFetle +C +d GpCk+ + +R+++n t+qCe+FiYgGC+GN+N+Fe+le ef03603 64 FCAFKADDGPCKAIM-KRFFFNIFTRQCEEFIYGGCEGNQNRFESLE 109 eCertCg<-* eC+++C ef03603 110 ECKKMCT 116 PF00014.13.fs: domain 2 of 2, from 135 to 187: score 97.9, E = 1.1e-33 *->iCslPpdsGpCkgsilpRyyYnpstgqCepFiYgGCgGNaNNFetle +C l d+G C+g+i +Ry+Yn +t+qCe+F+YgGC GN NNFetle ef03603 135 FCFLEEDPGICRGYI-TRYFYNNQTKQCERFKYGGCLGNMNNFETLE 180 eCertCg<-* eC+++C ef03603 181 ECKNICE 187 PF00014.13.ls: domain 2 of 2, from 135 to 187: score 99.9, E = 7.1e-27 *->iCslPpdsGpCkgsilpRyyYnpstgqCepFiYgGCgGNaNNFetle +C l d+G C+g+i +Ry+Yn +t+qCe+F+YgGC GN NNFetle ef03603 135 FCFLEEDPGICRGYI-TRYFYNNQTKQCERFKYGGCLGNMNNFETLE 180 eCertCg<-* eC+++C ef03603 181 ECKNICE 187 //