hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-10055103/chunk_1/iprscan-20080808-10055103.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ef04341 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00620.17.fs RhoGAP domain 220.4 9.6e-65 1 PF00620.17.ls RhoGAP domain 222.4 9.6e-64 1 PF00130.12.fs Phorbol esters/diacylglycerol binding domain 33.6 1.3e-08 1 PF00130.12.ls Phorbol esters/diacylglycerol binding domain 35.6 1.6e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00130.12.fs 1/1 290 341 .. 1 55 [] 33.6 1.3e-08 PF00130.12.ls 1/1 290 341 .. 1 55 [] 35.6 1.6e-07 PF00620.17.fs 1/1 366 516 .. 1 155 [] 220.4 9.6e-65 PF00620.17.ls 1/1 366 516 .. 1 155 [] 222.4 9.6e-64 Alignments of top-scoring domains: PF00130.12.fs: domain 1 of 1, from 290 to 341: score 33.6, E = 1.3e-08 *->HhFvhrwtfkqptfCdhCgeflwgslgkqGlkCswCklnvHkrChek H+Fv + t +p +C Cg+++ ++gk lkC++C ++ H +C + ef04341 290 HDFVSK-TVIKPESCVPCGKRI--KFGKLSLKCRDCRVVSHPECRDR 333 VppeCgcg<-* p C++ ef04341 334 CPLPCIPT 341 PF00130.12.ls: domain 1 of 1, from 290 to 341: score 35.6, E = 1.6e-07 *->HhFvhrwtfkqptfCdhCgeflwgslgkqGlkCswCklnvHkrChek H+Fv + t +p +C Cg+++ ++gk lkC++C ++ H +C + ef04341 290 HDFVSK-TVIKPESCVPCGKRI--KFGKLSLKCRDCRVVSHPECRDR 333 VppeCgcg<-* p C++ ef04341 334 CPLPCIPT 341 PF00620.17.fs: domain 1 of 1, from 366 to 516: score 220.4, E = 9.6e-65 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P iv++C++++e+rGL++ G+yR+sG+ ++keL+e+f r + v l ef04341 366 PSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPL- 411 dleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerlea + + d+h+++slLK+FLR+L ePLltf+l +f+e aa++ de++ + a ef04341 412 LSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFME-AAEITDEDNSIAA 460 lrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLlr +++++ +LP+aNrdtL++L+ hL+rVaq+ + +kM++ NLA vFgPt++ ef04341 461 MYQAVGELPQANRDTLAFLMIHLQRVAQSPH-TKMDVANLAKVFGPTIVA 509 ppdgdsad<-* + + ++d ef04341 510 HAVP-NPD 516 PF00620.17.ls: domain 1 of 1, from 366 to 516: score 222.4, E = 9.6e-64 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P iv++C++++e+rGL++ G+yR+sG+ ++keL+e+f r + v l ef04341 366 PSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPL- 411 dleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerlea + + d+h+++slLK+FLR+L ePLltf+l +f+e aa++ de++ + a ef04341 412 LSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFME-AAEITDEDNSIAA 460 lrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLlr +++++ +LP+aNrdtL++L+ hL+rVaq+ + +kM++ NLA vFgPt++ ef04341 461 MYQAVGELPQANRDTLAFLMIHLQRVAQSPH-TKMDVANLAKVFGPTIVA 509 ppdgdsad<-* + + ++d ef04341 510 HAVP-NPD 516 //