hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-15555476/chunk_1/iprscan-20080808-15555476.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: eh00571 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00320 127.5 1.5e-33 4 SM00589 86.3 3.7e-21 1 SM00336 49.5 4.4e-10 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00336 1/2 86 136 .. 1 51 [] 2.5 3 SM00336 2/2 140 179 .. 1 51 [] 47.0 2.5e-09 SM00589 1/1 386 439 .. 1 56 [] 86.3 3.7e-21 SM00320 1/4 766 805 .. 1 46 [] 25.3 0.0084 SM00320 2/4 808 845 .. 1 46 [] 42.7 4.9e-08 SM00320 3/4 848 884 .. 1 46 [] 27.5 0.0019 SM00320 4/4 887 924 .. 1 46 [] 32.0 8.2e-05 Alignments of top-scoring domains: SM00336: domain 1 of 2, from 86 to 136: score 2.5, E = 3 *->eraplCeeHgd...eepaeffCveedgallCrdCdeageHqanklfr ++++lC+++ d++++ +a+ C ++++ +C++ + Hq+n + eh00571 86 GKEVLCDFCLDdtrRVKAVKSC-LTCMVNYCEEHLQP--HQVNIKLQ 129 gHrvvll<-* +H eh00571 130 SHLLTEP 136 SM00336: domain 2 of 2, from 140 to 179: score 47.0, E = 2.5e-09 *->eraplCeeHgdeepaeffCveedgallCrdCdeageHqanklfrgHr + +++C+ H+ +p+ fC + d++++C dC+++ H +gH+ eh00571 140 HNWRYCPAHH--SPLSAFC-CPDQQCICQDCCQE--H------SGHT 175 vvll<-* +v+l eh00571 176 IVSL 179 SM00589: domain 1 of 1, from 386 to 439: score 86.3, E = 3.7e-21 *->avdvtLDPdTAhpkLlLSeDrrsVrygdtkqkGsnlpdnPeRFdsyp a+d+t+DPdTAh +L+L e +r+V++++++++ ++pd P RF ++ eh00571 386 AYDITFDPDTAHKYLRLQEENRKVTNTTPWEH--PYPDLPSRFLHWR 430 cVLGsegFs<-* +VL +++++ eh00571 431 QVLSQQSLY 439 SM00320: domain 1 of 4, from 766 to 805: score 25.3, E = 0.0084 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +++gH g +V+++ + n+l+sgs D +ir W eh00571 766 VkAIPVEFRGHAG--SVRALFLCEEE------NFLLSGSyDLSIRYW 804 d<-* d eh00571 805 D 805 SM00320: domain 2 of 4, from 808 to 845: score 42.7, E = 4.9e-08 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW ++ ++r++ gH+g +t+++ + + +l+sg++D+++++W eh00571 808 SgVCTRIFGGHQG--TITCMDLCKN--------RLVSGGrDCQVKVW 844 d<-* d eh00571 845 D 845 SM00320: domain 3 of 4, from 848 to 884: score 27.5, E = 0.0019 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW t+k+l+t++ H++ p+++ +++++ +++s+++ g +++W eh00571 848 TgKCLKTFR-HKD--PILATRINDT--------YIVSSCeRGLVKVW 883 d<-* + eh00571 884 H 884 SM00320: domain 4 of 4, from 887 to 924: score 32.0, E = 8.2e-05 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW +l++tl+gH+g +V ++ f++ +l+sgs+Dg + W eh00571 887 MaQLVKTLSGHEG--AVKCLFFDQW--------HLLSGStDGLVMAW 923 d<-* + eh00571 924 S 924 //