hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-17410965/chunk_1/iprscan-20080808-17410965.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: eh00752 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00787.14.fs PX domain 93.5 5.2e-28 1 PF00787.14.ls PX domain 95.4 1.6e-25 1 PF00614.12.ls Phospholipase D Active site motif 73.7 5.2e-19 2 PF00614.12.fs Phospholipase D Active site motif 69.8 6.3e-19 2 PF00169.19.fs PH domain 43.9 6.6e-13 1 PF00169.19.ls PH domain 45.9 1.2e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00787.14.fs 1/1 102 232 .. 1 131 [] 93.5 5.2e-28 PF00787.14.ls 1/1 102 232 .. 1 131 [] 95.4 1.6e-25 PF00169.19.fs 1/1 243 351 .. 1 92 [] 43.9 6.6e-13 PF00169.19.ls 1/1 243 351 .. 1 92 [] 45.9 1.2e-10 PF00614.12.ls 1/2 482 509 .. 1 29 [] 40.5 5.3e-09 PF00614.12.fs 1/2 482 509 .. 1 29 [] 38.5 5.3e-10 PF00614.12.fs 2/2 876 903 .. 1 29 [] 31.3 6.4e-08 PF00614.12.ls 2/2 876 903 .. 1 29 [] 33.2 8.2e-07 Alignments of top-scoring domains: PF00787.14.fs: domain 1 of 1, from 102 to 232: score 93.5, E = 5.2e-28 *->dpili.vvvvdpetsrkkegdkkhtyyvyevttktn.kewsVkRRYs pi+ +v +v+++ts +++ + +y++++++++++w+VkR+++ eh00752 102 CPIKAqVLEVERFTS----TTRVPSINLYTIELTHGeFKWQVKRKFK 144 dFeeLhekLlrkfpgrilPplPpKklfgryr.k.es.lpmtsvwh.ssnn +F+e+h+ Ll++ ++++P + ++++f+r++ ++e+++ m+s+ ++s+n+ eh00752 145 HFQEFHRELLKYKAFIRIPIPTRRHTFRRQNvReEPrE-MPSLPRsSENM 193 fdeefiekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* ee++ Rrk+Le+yL+++l++P+++n ++ +eFL + eh00752 194 IREEQFLGRRKQLEDYLTKILKMPMYRN-YHATTEFLDIS 232 PF00787.14.ls: domain 1 of 1, from 102 to 232: score 95.4, E = 1.6e-25 *->dpili.vvvvdpetsrkkegdkkhtyyvyevttktn.kewsVkRRYs pi+ +v +v+++ts +++ + +y++++++++++w+VkR+++ eh00752 102 CPIKAqVLEVERFTS----TTRVPSINLYTIELTHGeFKWQVKRKFK 144 dFeeLhekLlrkfpgrilPplPpKklfgryr.k.es.lpmtsvwh.ssnn +F+e+h+ Ll++ ++++P + ++++f+r++ ++e+++ m+s+ ++s+n+ eh00752 145 HFQEFHRELLKYKAFIRIPIPTRRHTFRRQNvReEPrE-MPSLPRsSENM 193 fdeefiekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* ee++ Rrk+Le+yL+++l++P+++n ++ +eFL + eh00752 194 IREEQFLGRRKQLEDYLTKILKMPMYRN-YHATTEFLDIS 232 PF00169.19.fs: domain 1 of 1, from 243 to 351: score 43.9, E = 6.6e-13 *->vikeGwLlkkg...............gkkswkkRyfvLfddvLlyyk +eG ++k++++++ ++ + ++++++ +w kR+++++d+ Lly k eh00752 243 KGIEGMIMKRSgghripglnccgqgrACYRWSKRWLIVKDSFLLYMK 289 dkkkkpkgsipLsgi.qvtkvpdn.krkncFeirt.dretlllqaeseee +++ +++ +++ +++ ++ ++ k++++i + +r tl+l+++s+ + eh00752 290 PDSGAIAFVLLVDKEfKIKVGKKEtETKYGIRIDNlSR-TLILKCNSYRH 338 rkeWvkaiqsair<-* ++ W ai++ i eh00752 339 ARWWGGAIEEFIQ 351 PF00169.19.ls: domain 1 of 1, from 243 to 351: score 45.9, E = 1.2e-10 *->vikeGwLlkkg...............gkkswkkRyfvLfddvLlyyk +eG ++k++++++ ++ + ++++++ +w kR+++++d+ Lly k eh00752 243 KGIEGMIMKRSgghripglnccgqgrACYRWSKRWLIVKDSFLLYMK 289 dkkkkpkgsipLsgi.qvtkvpdn.krkncFeirt.dretlllqaeseee +++ +++ +++ +++ ++ ++ k++++i + +r tl+l+++s+ + eh00752 290 PDSGAIAFVLLVDKEfKIKVGKKEtETKYGIRIDNlSR-TLILKCNSYRH 338 rkeWvkaiqsair<-* ++ W ai++ i eh00752 339 ARWWGGAIEEFIQ 351 PF00614.12.ls: domain 1 of 2, from 482 to 509: score 40.5, E = 5.3e-09 *->ydgrlHqKivvvDdeivafiGgaNldgrs<-* y +++H+K+v++D vaf+Gg++l++++ eh00752 482 YLWAHHEKLVIIDQS-VAFVGGIDLAYGR 509 PF00614.12.fs: domain 1 of 2, from 482 to 509: score 38.5, E = 5.3e-10 *->ydgrlHqKivvvDdeivafiGgaNldgrs<-* y +++H+K+v++D vaf+Gg++l++++ eh00752 482 YLWAHHEKLVIIDQS-VAFVGGIDLAYGR 509 PF00614.12.fs: domain 2 of 2, from 876 to 903: score 31.3, E = 6.4e-08 *->ydgrlHqKivvvDdeivafiGgaNldgrs<-* + +++H+K+++ Dd ++iG+aN+++rs eh00752 876 ELIYVHSKLLIADDN-TVIIGSANINDRS 903 PF00614.12.ls: domain 2 of 2, from 876 to 903: score 33.2, E = 8.2e-07 *->ydgrlHqKivvvDdeivafiGgaNldgrs<-* + +++H+K+++ Dd ++iG+aN+++rs eh00752 876 ELIYVHSKLLIADDN-TVIIGSANINDRS 903 //