hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-05560135/chunk_1/iprscan-20090618-05560135.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ej00442 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.ls Helix-loop-helix DNA-binding domain 79.9 7.4e-21 1 PF00010.16.fs Helix-loop-helix DNA-binding domain 77.9 2.6e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 192 244 .. 1 53 [] 77.9 2.6e-20 PF00010.16.ls 1/1 192 244 .. 1 53 [] 79.9 7.4e-21 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 192 to 244: score 77.9, E = 2.6e-20 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR n rER R +++N af+eLr+l+Pt++p+kKlsK eiLrlA + ej00442 192 RRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMK 238 YIksLq<-* YI++L ej00442 239 YINFLA 244 PF00010.16.ls: domain 1 of 1, from 192 to 244: score 79.9, E = 7.4e-21 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR n rER R +++N af+eLr+l+Pt++p+kKlsK eiLrlA + ej00442 192 RRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMK 238 YIksLq<-* YI++L ej00442 239 YINFLA 244 //