hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-06145187/chunk_1/iprscan-20090618-06145187.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ej00503 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00761 230.4 1.6e-64 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00761 1/1 558 658 .. 1 103 [] 230.4 1.6e-64 Alignments of top-scoring domains: SM00761: domain 1 of 1, from 558 to 658: score 230.4, E = 1.6e-64 *->nCkrlGPSYRlLPksekqpkCSGRdeLcDkeVLNDtWVShPtwaSED +CkrlG+SYR+LPks++qpkC+GR++Lc keVLNDtWVS+P+w+ ED ej00503 558 SCKRLGSSYRALPKSYQQPKCTGRTPLC-KEVLNDTWVSFPSWS-ED 602 sgFvahrKNqYEEaLfrcEDERfElDmviEsnsstIklLeeilnkisdms s+Fv+++K+qYEE+++rcEDERfElD+v+E+n++tI++Le i++k+s++s ej00503 603 STFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLS 652 deeran<-* ee+a+ ej00503 653 AEEQAK 658 //