hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-19261274/chunk_1/iprscan-20080808-19261274.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ej00608 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00091 92.7 4.3e-23 2 SM00086 45.1 9.1e-09 1 SM00353 45.0 9.8e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00353 1/1 31 86 .. 1 61 [] 45.0 9.8e-09 SM00091 1/2 95 161 .. 1 68 [] 49.2 5.3e-10 SM00091 2/2 238 304 .. 1 68 [] 43.5 2.8e-08 SM00086 1/1 310 353 .. 1 43 [] 45.1 9.1e-09 Alignments of top-scoring domains: SM00353: domain 1 of 1, from 31 to 86: score 45.0, E = 9.8e-09 *->narERrlrRRekiNeqafdeLrslvPtlpkgggnskKlsKasiLrlA + R RR k e f+eL+ +P + + s+ l+Kas+ rl+ ej00608 31 RDAAR--SRRSKESE-VFYELAHQLPLPH---NVSSHLDKASVMRLT 71 ieYIr.ksLqeqlqe<-* i+Y+r ++L ++ + ej00608 72 ISYLRvRKLLDAGDL 86 SM00091: domain 1 of 2, from 95 to 161: score 49.2, E = 5.3e-10 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll +++ l +l+ +++vl+ dG+++y+++++ +++G+++ el G+s++ ej00608 95 QMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVF 141 elihpedrlleevqe.lqrlla<-* ++ hp d+ ee++e l + ej00608 142 DFTHPCDH--EEMREmLTHRNG 161 SM00091: domain 2 of 2, from 238 to 304: score 43.5, E = 2.8e-08 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + + +i + +++ +++ld+++ y++++++el+Gy+peel+G+s++ ej00608 238 PSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIY 284 elihpedrlleevqe.lqrlla<-* e++h d +++ ++ + + ej00608 285 EYYHALDS--DHLTKtHHDMFT 304 SM00086: domain 1 of 1, from 310 to 353: score 45.1, E = 9.1e-09 *->tveyrlrrkdGsliwvlvsaspird.edgevegilgvvrDITer<-* t++yr+++k G+++wv+++a++i+++++ ++++i++v+++++ ej00608 310 TGQYRMLAKRGGYVWVETQATVIYNtKNSQPQCIVCVNYVVSGI 353 //