hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-20041512/chunk_1/iprscan-20080808-20041512.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ej00702 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00110 212.7 3.2e-59 1 SM00181 37.2 2.2e-06 1 SM00179 25.0 0.0013 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00181 1/1 1052 1085 .. 1 32 [] 37.2 2.2e-06 SM00179 1/1 1053 1085 .. 1 34 [] 25.0 0.0013 SM00110 1/1 1102 1236 .] 1 146 [] 212.7 3.2e-59 Alignments of top-scoring domains: SM00181: domain 1 of 1, from 1052 to 1085: score 37.2, E = 2.2e-06 *->eCa..pCsnGgtEqnGtCi....sytC.CpgpGytg.rCe<-* C+++pC+nG GtCi++++s+tC C+ + +tg++C ej00702 1052 SCSrhPCQNG-----GTCIngrtSFTCaCR-HPFTGdNCT 1085 SM00179: domain 1 of 1, from 1053 to 1085: score 25.0, E = 0.0013 *->DiDEC...pCqnGGptgtCiN.vGSYrC.CppGyt.rnCe<-* C+++pCqnGG tCiN+ S++C C+ +t+ nC+ ej00702 1053 ----CsrhPCQNGG---TCINgRTSFTCaCRHPFTgDNCT 1085 SM00110: domain 1 of 1, from 1102 to 1236: score 212.7, E = 3.2e-59 *->eykakprsAFsvilsyterpPpEmNpgqpirFdkvLyNqqghYdpsT +y+++p++AF+++++y++++P+ pi+F+++++N++++Y+p+T ej00702 1102 SYRYAPMVAFFASHTYGMTIPG------PILFNNLDVNYGASYTPRT 1142 GkFtCpvPGvYyFsYhievkgrRqnvkvsLmkngiqvlrvvstydeyqkg GkF++p+ GvY+F+Y+ie++++ +++++L+++gi++l+++s++++++++ ej00702 1143 GKFRIPYLGVYVFKYTIESFSA--HISGFLVVDGIDKLAFESENINSEIH 1190 lydvaSGgalLqLeqGDqVWLelddeeknglyageevdSvFSGFLLfpd< +++v++G+alL+L++G++VWL+l++ ++++a+++++++FSG+LL+++ ej00702 1191 CDRVLTGDALLELNYGQEVWLRLAK---GTIPAKFPPVTTFSGYLLYRT 1236 -* ej00702 - - //