hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080808/iprscan-20080808-20170182/chunk_1/iprscan-20080808-20170182.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ej00768
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00667                                                  28.3     0.0011   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00667    1/1      90   122 ..     1    33 []    28.3   0.0011

Alignments of top-scoring domains:
SM00667: domain 1 of 1, from 90 to 122: score 28.3, E = 0.0011
                   *->rrselnrlileYLlenGyketaetlqkEtglsl<-*
                      +++ ln+l+ e+Ll+n+yk t  t+  E + ++   
     ej00768    90    EKRALNFLVNEFLLKNNYKLTSITFSDENDDQD    122  

//