hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-02042865/chunk_1/iprscan-20080809-02042865.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ff01534
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00398                                                  79.8    3.3e-19   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00398    1/1     278   348 ..     1    71 []    79.8  3.3e-19

Alignments of top-scoring domains:
SM00398: domain 1 of 1, from 278 to 348: score 79.8, E = 3.3e-19
                   *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee
                       p +P sa+ lF  +  a ik +nP+++++e+sK+++ +W  L ee+
     ff01534   278    EPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ 324  

                   KapYeekAekdkeryekempeykk<-*
                   K+ Y+ k e++k++y k++++y++   
     ff01534   325 KQVYKRKTEAAKKEYLKALAAYRA    348  

//