hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-02194521/chunk_1/iprscan-20080809-02194521.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ff01868
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00326                                                  70.1    2.8e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00326    1/1     302   358 .]     1    58 []    70.1  2.8e-16

Alignments of top-scoring domains:
SM00326: domain 1 of 1, from 302 to 358: score 70.1, E = 2.8e-16
                   *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG
                        ++AlYDy+a ++ E+sF +   it +e +d+gWw+G    +G  G
     ff01868   302    LCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGP-DGHFG 347  

                   lfPsnYVeeie<-*
                   +fP+nYVe+ie   
     ff01868   348 MFPANYVELIE    358  

//