hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-07293022/chunk_1/iprscan-20090618-07293022.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ff06095
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00647                                                  87.9    1.2e-21   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00647    1/2     188   249 ..     1    78 []    74.5  1.3e-17
SM00647    2/2     285   352 ..     1    78 []    13.4     0.09

Alignments of top-scoring domains:
SM00647: domain 1 of 2, from 188 to 249: score 74.5, E = 1.3e-17
                   *->ekYerlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgasd
                      ++Y+rlll+s+++ ++d+++CP+  C+ +   +              
     ff06095   188    ARYDRLLLQSSLDLMADVVYCPR-PCCQLPVMQ-------------- 219  

                   eegcnrvtCprkCgfsFCfrCkvewHspvsC<-*
                   e+gc++ +C+ +C+f+FC+ C++++H+ + C   
     ff06095   220 EPGCTMGICS-SCNFAFCTLCRLTYHGVSPC    249  

SM00647: domain 2 of 2, from 285 to 352: score 13.4, E = 0.09
                   *->ekYerlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgasd
                      +  e+++ ++++e+  ++k CP   C++ i++               
     ff06095   285    KALEEMESKEWLEK--NSKSCP--CCGTPIEKL-------------- 313  

                   eegcnrvtCprkCgfsFCfrCkvew.......Hspv...sC<-*
                    +gcn++tC  +C   FC+ C+   ++ ++ +H + +++ C   
     ff06095   314 -DGCNKMTCT-GCMQYFCWICMGSLsranpykHFNDpgsPC    352  

//