hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-05580447/chunk_1/iprscan-20080809-05580447.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fg01237
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model      Description                                  Score    E-value  N 
--------   -----------                                  -----    ------- ---
PF03832.4.ls Protein kinase A anchor                      146.9    5.1e-41   3
PF03832.4.fs Protein kinase A anchor                      140.9    2.7e-39   3

Parsed for domains:
Model      Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------   ------- ----- -----    ----- -----      -----  -------
PF03832.4.fs   1/3     612   642 ..     1    31 []    49.0  4.6e-13
PF03832.4.ls   1/3     612   642 ..     1    31 []    51.0  3.7e-12
PF03832.4.fs   2/3     761   791 ..     1    31 []    51.6  8.1e-14
PF03832.4.ls   2/3     761   791 ..     1    31 []    53.6    6e-13
PF03832.4.fs   3/3     806   836 ..     1    31 []    40.3  1.4e-10
PF03832.4.ls   3/3     806   836 ..     1    31 []    42.3  1.6e-09

Alignments of top-scoring domains:
PF03832.4.fs: domain 1 of 3, from 612 to 642: score 49.0, E = 4.6e-13
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      reg+++WaSfK++Vtp+K++r+++e+++e++   
     fg01237   612    REGVTPWASFKKMVTPKKRVRRPSESDKEDE    642  

PF03832.4.ls: domain 1 of 3, from 612 to 642: score 51.0, E = 3.7e-12
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      reg+++WaSfK++Vtp+K++r+++e+++e++   
     fg01237   612    REGVTPWASFKKMVTPKKRVRRPSESDKEDE    642  

PF03832.4.fs: domain 2 of 3, from 761 to 791: score 51.6, E = 8.1e-14
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      +eg+++W+SfKrLVtpRKks+s+ e+k e++   
     fg01237   761    GEGVSTWESFKRLVTPRKKSKSKLEEKSEDS    791  

PF03832.4.ls: domain 2 of 3, from 761 to 791: score 53.6, E = 6e-13
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      +eg+++W+SfKrLVtpRKks+s+ e+k e++   
     fg01237   761    GEGVSTWESFKRLVTPRKKSKSKLEEKSEDS    791  

PF03832.4.fs: domain 3 of 3, from 806 to 836: score 40.3, E = 1.4e-10
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      +++e++W+S+K+++++R+k+r d++q+++ +   
     fg01237   806    PGKEESWVSIKKFIPGRRKKRPDGKQEQAPV    836  

PF03832.4.ls: domain 3 of 3, from 806 to 836: score 42.3, E = 1.6e-09
                   *->regegaWaSfKrLVtpRKksrsdkeqkpeea<-*
                      +++e++W+S+K+++++R+k+r d++q+++ +   
     fg01237   806    PGKEESWVSIKKFIPGRRKKRPDGKQEQAPV    836  

//