hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-06043104/chunk_1/iprscan-20080809-06043104.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fg01250 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00023.20.ls Ankyrin repeat 108.3 2.1e-29 3 PF00023.20.fs Ankyrin repeat 102.3 1.3e-27 3 PF00560.23.ls Leucine Rich Repeat 21.8 0.0023 3 PF07723.3.ls Leucine Rich Repeat 12.7 0.27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00023.20.ls 1/3 228 260 .. 1 33 [] 26.2 0.0001 PF00023.20.fs 1/3 228 260 .. 1 33 [] 24.2 8.9e-06 PF00023.20.fs 2/3 261 293 .. 1 33 [] 39.3 5.5e-10 PF00023.20.ls 2/3 261 293 .. 1 33 [] 41.3 3e-09 PF00023.20.fs 3/3 297 329 .. 1 33 [] 38.7 8.2e-10 PF00023.20.ls 3/3 297 329 .. 1 33 [] 40.7 4.6e-09 PF00560.23.ls 3/3 830 856 .. 1 24 [] 8.2 7.8 PF07723.3.ls 1/1 830 857 .. 1 26 [] 12.7 0.27 Alignments of top-scoring domains: PF00023.20.ls: domain 1 of 3, from 228 to 260: score 26.2, E = 0.0001 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+T LH A++ g+l+ v++L+ qG ln +d fg01250 228 MGETLLHRACIEGQLRRVQDLVRQGHPLNPRDY 260 PF00023.20.fs: domain 1 of 3, from 228 to 260: score 24.2, E = 8.9e-06 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+T LH A++ g+l+ v++L+ qG ln +d fg01250 228 MGETLLHRACIEGQLRRVQDLVRQGHPLNPRDY 260 PF00023.20.fs: domain 2 of 3, from 261 to 293: score 39.3, E = 5.5e-10 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+TPLH A+ +g+le+v++Ll++GA ++ fg01250 261 CGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGG 293 PF00023.20.ls: domain 2 of 3, from 261 to 293: score 41.3, E = 3e-09 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+TPLH A+ +g+le+v++Ll++GA ++ fg01250 261 CGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGG 293 PF00023.20.fs: domain 3 of 3, from 297 to 329: score 38.7, E = 8.2e-10 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G TPLH A +g+ ev++lLl++GA++ ++++ fg01250 297 EGITPLHDALNCGHFEVAELLLERGASVTLRTR 329 PF00023.20.ls: domain 3 of 3, from 297 to 329: score 40.7, E = 4.6e-09 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G TPLH A +g+ ev++lLl++GA++ ++++ fg01250 297 EGITPLHDALNCGHFEVAELLLERGASVTLRTR 329 PF00560.23.ls: domain 3 of 3, from 830 to 856: score 8.2, E = 7.8 *->nLeeLdLsgCNpsltgs.....lpssl.nl<-* +LeeLdLs N +l g++++ +l+s l+ + fg01250 830 SLEELDLSM-N-PL-GDgcgqsLASLLhAC 856 PF07723.3.ls: domain 1 of 1, from 830 to 857: score 12.7, E = 0.27 *->sLKtLhLdsVkf..sddeslekLLSgCP<-* sL L+L+ + +++ ++ sl +LL +CP fg01250 830 SLEELDLSMNPLgdGCGQSLASLLHACP 857 //