hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-06281146/chunk_1/iprscan-20080809-06281146.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fg01431 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00432 110.0 2.7e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00432 1/1 151 210 .. 1 60 [] 110.0 2.7e-28 Alignments of top-scoring domains: SM00432: domain 1 of 1, from 151 to 210: score 110.0, E = 2.7e-28 *->MgRgKieIkrIeNktnRqVTFSKRRnGLfKKAhELSvLCDAeValIv gR Ki++++I+Nk +R +TFSKR++G++KKA+ELS+L++++V+l+v fg01431 151 RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLV 197 fSptGklyefasp<-* S+tG++y+fa++ fg01431 198 ASETGHVYTFATR 210 //