hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-08322881/chunk_1/iprscan-20080809-08322881.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fg04081 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00319.9.fs SRF-type transcription factor (DNA-binding a 91.8 3.2e-25 1 PF00319.9.ls SRF-type transcription factor (DNA-binding a 93.8 4.7e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00319.9.fs 1/1 14 64 .. 1 51 [] 91.8 3.2e-25 PF00319.9.ls 1/1 14 64 .. 1 51 [] 93.8 4.7e-25 Alignments of top-scoring domains: PF00319.9.fs: domain 1 of 1, from 14 to 64: score 91.8, E = 3.2e-25 *->krIenksnrqVTfsKRrnGllKKAhELSVLCdaeVaviifsstGkly +rI +++nrqVTf+KR+ Gl+KKA+ELSVLCd e+a+iif +++kl+ fg04081 14 QRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLF 60 eyss<-* y+s fg04081 61 QYAS 64 PF00319.9.ls: domain 1 of 1, from 14 to 64: score 93.8, E = 4.7e-25 *->krIenksnrqVTfsKRrnGllKKAhELSVLCdaeVaviifsstGkly +rI +++nrqVTf+KR+ Gl+KKA+ELSVLCd e+a+iif +++kl+ fg04081 14 QRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLF 60 eyss<-* y+s fg04081 61 QYAS 64 //