hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-08322881/chunk_1/iprscan-20080809-08322881.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fg04081 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00432 140.9 1.3e-37 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00432 1/1 6 65 .. 1 60 [] 140.9 1.3e-37 Alignments of top-scoring domains: SM00432: domain 1 of 1, from 6 to 65: score 140.9, E = 1.3e-37 *->MgRgKieIkrIeNktnRqVTFSKRRnGLfKKAhELSvLCDAeValIv MgR+Ki+I+rI++++nRqVTF+KR++GL+KKA+ELSvLCD+e+alI+ fg04081 6 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALII 52 fSptGklyefasp<-* f +++kl+++as+ fg04081 53 FNHSNKLFQYAST 65 //