hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-09541200/chunk_1/iprscan-20080809-09541200.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fg06748 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.ls Helix-loop-helix DNA-binding domain 81.4 2.7e-21 1 PF00010.16.fs Helix-loop-helix DNA-binding domain 79.4 1e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 103 154 .. 1 53 [] 79.4 1e-20 PF00010.16.ls 1/1 103 154 .. 1 53 [] 81.4 2.7e-21 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 103 to 154: score 79.4, E = 1e-20 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR+ +n ERrR+++iN +f++L++l+P+ +++KlsKa+iL+++ e fg06748 103 RREIANSNERRRMQSINAGFQSLKTLIPH-TDGEKLSKAAILQQTAE 148 YIksLq<-* YI sL+ fg06748 149 YIFSLE 154 PF00010.16.ls: domain 1 of 1, from 103 to 154: score 81.4, E = 2.7e-21 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR+ +n ERrR+++iN +f++L++l+P+ +++KlsKa+iL+++ e fg06748 103 RREIANSNERRRMQSINAGFQSLKTLIPH-TDGEKLSKAAILQQTAE 148 YIksLq<-* YI sL+ fg06748 149 YIFSLE 154 //