hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-10135601/chunk_1/iprscan-20080809-10135601.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh00060
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00291                                                  66.8    2.7e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00291    1/1     230   275 ..     1    46 []    66.8  2.7e-15

Alignments of top-scoring domains:
SM00291: domain 1 of 1, from 230 to 275: score 66.8, E = 2.7e-15
                   *->vhhsvsCdgCgkepivgvRYkClvCpDYDLCesCfakGghhgeHam<
                      v+h+ +C++C+++pi g+RY++l+ ++ D+C++Cf +G++++ +++ 
     fh00060   230    VKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKL  275  

                   -*
                     
     fh00060     -    -    

//