hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-11143753/chunk_1/iprscan-20080809-11143753.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh02544 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00867.9.ls XPG I-region 171.9 1.5e-48 1 PF00867.9.fs XPG I-region 170.1 5.3e-48 1 PF00752.8.fs XPG N-terminal domain 122.7 2.4e-35 1 PF00752.8.ls XPG N-terminal domain 101.7 2e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00752.8.ls 1/1 442 523 .. 1 111 [] 101.7 2e-27 PF00752.8.fs 1/1 456 523 .. 37 111 .] 122.7 2.4e-35 PF00867.9.fs 1/1 1202 1290 .. 1 103 [] 170.1 5.3e-48 PF00867.9.ls 1/1 1202 1290 .. 1 103 [] 171.9 1.5e-48 Alignments of top-scoring domains: PF00752.8.ls: domain 1 of 1, from 442 to 523: score 101.7, E = 2e-27 *->MGIkGLlpiLkpvapeairsvsiEalegYYkvLAiDasiwLyqfLka + ++ ++ + ++ +siwL+q+Lk+ fh02544 442 ---------ASFHQ-----DSAWKKMSN--------ISIWLNQALKG 466 vRdqlgnnlenEeGettshlmglfsRlcrLldfgIkPifVFDGgapndlK vRd++gn++en +hl++lf+Rlc+Ll+f+I+PifVFDG+ap lK fh02544 467 VRDRHGNSIEN------PHLLTLFHRLCKLLFFRIRPIFVFDGDAP-LLK 509 aetlqKRsarrqea<-* ++tl+KR++r++ a fh02544 510 KQTLVKRRQRKDLA 523 PF00752.8.fs: domain 1 of 1, from 456 to 523: score 122.7, E = 2.4e-35 *->asiwLyqfLkavRdqlgnnlenEeGettshlmglfsRlcrLldfgIk +siwL+q+Lk+vRd++gn++en +hl++lf+Rlc+Ll+f+I+ fh02544 456 ISIWLNQALKGVRDRHGNSIEN------PHLLTLFHRLCKLLFFRIR 496 PifVFDGgapndlKaetlqKRsarrqea<-* PifVFDG+ap lK++tl+KR++r++ a fh02544 497 PIFVFDGDAP-LLKKQTLVKRRQRKDLA 523 PF00867.9.fs: domain 1 of 1, from 1202 to 1290: score 170.1, E = 5.3e-48 *->rlmGIpyIvAPigEAEAQcayLekkglvdgiiTeDsDvLLFGaprll rl+GIpyI+AP +EAEAQca L+ ++++g+iT+DsD++LFGa++++ fh02544 1202 RLFGIPYIQAP-MEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVY 1247 rnLtdfGscLeiskekfklPveiidlekilkelgKKlsreqLidlaiLlG rn++ +k+kf ve++++ ++ ++lg l+r++Li+la+LlG fh02544 1248 RNFF--------NKNKF---VEYYQYVDFHNQLG--LDRNKLINLAYLLG 1284 cDYteG<-* +DYteG fh02544 1285 SDYTEG 1290 PF00867.9.ls: domain 1 of 1, from 1202 to 1290: score 171.9, E = 1.5e-48 *->rlmGIpyIvAPigEAEAQcayLekkglvdgiiTeDsDvLLFGaprll rl+GIpyI+AP +EAEAQca L+ ++++g+iT+DsD++LFGa++++ fh02544 1202 RLFGIPYIQAP-MEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVY 1247 rnLtdfGscLeiskekfklPveiidlekilkelgKKlsreqLidlaiLlG rn++ +k+kf ve++++ ++ ++lg l+r++Li+la+LlG fh02544 1248 RNFF--------NKNKF---VEYYQYVDFHNQLG--LDRNKLINLAYLLG 1284 cDYteG<-* +DYteG fh02544 1285 SDYTEG 1290 //