hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-13532162/chunk_1/iprscan-20080809-13532162.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh09317 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00929.14.fs Exonuclease 35.7 1.3e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00929.14.fs 1/1 43 129 .. 84 187 .] 35.7 1.3e-10 Alignments of top-scoring domains: PF00929.14.fs: domain 1 of 1, from 43 to 129: score 35.7, E = 1.3e-10 *->efleflkklsilvahnnkkasfdvgfllyddlrflklphpfsnikin ++l++lk +++ v+h l++d+++lk+ hp+s fh09317 43 QILKLLK-GKVVVGHA-----------LHNDFQALKYVHPRS---QT 74 dvidtlilakkafkgfkrgraktsLdaLaeklglefiqren.iaHrAldD +++ ++ + + + r r sL++La +l++++iq ++ +H++++D fh09317 75 RDTTYVPNFLSEPGLHTRAR--VSLKDLALQLLHKKIQV-GqHGHSSVED 121 Arataelf<-* A +++el+ fh09317 122 ATTAMELY 129 //