hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090526/iprscan-20090526-15453384/chunk_1/iprscan-20090526-15453384.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh12350 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00096.16.fs Zinc finger, C2H2 type 234.8 1.7e-67 12 PF00096.16.ls Zinc finger, C2H2 type 234.0 3e-67 9 PF01352.17.fs KRAB box 93.2 7.6e-26 1 PF01352.17.ls KRAB box 95.2 1.9e-25 1 PF01096.9.fs Transcription factor S-II (TFIIS) 37.6 6.1e-11 7 PF01286.9.fs XPA protein N-terminal 28.1 3.1e-07 8 PF07754.2.fs Domain of unknown function (DUF1610) 23.9 2.3e-05 7 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01352.17.ls 1/1 3 43 .. 1 41 [] 95.2 1.9e-25 PF01352.17.fs 1/1 3 43 .. 1 41 [] 93.2 7.6e-26 PF00096.16.fs 2/12 171 193 .. 1 24 [] 24.9 5.9e-05 PF00096.16.ls 1/9 171 193 .. 1 24 [] 26.9 6.8e-05 PF00096.16.ls 2/9 199 221 .. 1 24 [] 33.0 9.6e-07 PF00096.16.fs 3/12 199 221 .. 1 24 [] 31.0 1.7e-06 PF00096.16.ls 3/9 227 249 .. 1 24 [] 19.7 0.0096 PF00096.16.ls 4/9 255 277 .. 1 24 [] 26.9 6.5e-05 PF00096.16.fs 5/12 255 277 .. 1 24 [] 25.0 5.7e-05 PF00096.16.ls 5/9 283 305 .. 1 24 [] 24.2 0.00044 PF00096.16.ls 6/9 339 361 .. 1 24 [] 36.2 1e-07 PF00096.16.fs 8/12 339 361 .. 1 24 [] 34.3 2.7e-07 PF00096.16.ls 7/9 367 389 .. 1 24 [] 28.5 2.2e-05 PF00096.16.fs 9/12 367 389 .. 1 24 [] 26.5 2.4e-05 PF00096.16.ls 8/9 395 417 .. 1 24 [] 30.4 6.1e-06 PF00096.16.fs 10/12 395 417 .. 1 24 [] 28.4 8e-06 Alignments of top-scoring domains: PF01352.17.ls: domain 1 of 1, from 3 to 43: score 95.2, E = 1.9e-25 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* VtF+DVaV Ft+EE +lLd aQr+LYrdVMlEN++nL+S+g fh12350 3 VTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVG 43 PF01352.17.fs: domain 1 of 1, from 3 to 43: score 93.2, E = 7.6e-26 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* VtF+DVaV Ft+EE +lLd aQr+LYrdVMlEN++nL+S+g fh12350 3 VTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVG 43 PF00096.16.fs: domain 2 of 12, from 171 to 193: score 24.9, E = 5.9e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +CgksF+ s L+ H+r+H fh12350 171 HSCD-ECGKSFCYISALHIHQRVH 193 PF00096.16.ls: domain 1 of 9, from 171 to 193: score 26.9, E = 6.8e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +CgksF+ s L+ H+r+H fh12350 171 HSCD-ECGKSFCYISALHIHQRVH 193 PF00096.16.ls: domain 2 of 9, from 199 to 221: score 33.0, E = 9.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +Cgk Fs++ +L++H+r+H fh12350 199 FKCD-VCGKEFSQSLHLQTHQRVH 221 PF00096.16.fs: domain 3 of 12, from 199 to 221: score 31.0, E = 1.7e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +Cgk Fs++ +L++H+r+H fh12350 199 FKCD-VCGKEFSQSLHLQTHQRVH 221 PF00096.16.ls: domain 3 of 9, from 227 to 249: score 19.7, E = 0.0096 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +Cg+ F+ +s L+ H + H fh12350 227 FKCE-QCGRGFRCRSALTVHCKLH 249 PF00096.16.ls: domain 4 of 9, from 255 to 277: score 26.9, E = 6.5e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ Cg++F + +L++H+r+H fh12350 255 YNCE-ACGRAFIHDFQLQKHQRIH 277 PF00096.16.fs: domain 5 of 12, from 255 to 277: score 25.0, E = 5.7e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ Cg++F + +L++H+r+H fh12350 255 YNCE-ACGRAFIHDFQLQKHQRIH 277 PF00096.16.ls: domain 5 of 9, from 283 to 305: score 24.2, E = 0.00044 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +C sF+ +s+L+rH +H fh12350 283 FKCE-ICSVSFRLRSSLNRHCVVH 305 PF00096.16.ls: domain 6 of 9, from 339 to 361: score 36.2, E = 1e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ +CgksF+r+s L H+r+H fh12350 339 YNCK-ECGKSFRRSSYLLIHQRVH 361 PF00096.16.fs: domain 8 of 12, from 339 to 361: score 34.3, E = 2.7e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ +CgksF+r+s L H+r+H fh12350 339 YNCK-ECGKSFRRSSYLLIHQRVH 361 PF00096.16.ls: domain 7 of 9, from 367 to 389: score 28.5, E = 2.2e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ +Cgks+ +ks L H r H fh12350 367 YKCD-KCGKSYITKSGLDLHHRAH 389 PF00096.16.fs: domain 9 of 12, from 367 to 389: score 26.5, E = 2.4e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ +Cgks+ +ks L H r H fh12350 367 YKCD-KCGKSYITKSGLDLHHRAH 389 PF00096.16.ls: domain 8 of 9, from 395 to 417: score 30.4, E = 6.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ dCgksF++ s+ +H+r H fh12350 395 YNCD-DCGKSFRQASSILNHKRLH 417 PF00096.16.fs: domain 10 of 12, from 395 to 417: score 28.4, E = 8e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ dCgksF++ s+ +H+r H fh12350 395 YNCD-DCGKSFRQASSILNHKRLH 417 //