hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-16570641/chunk_1/iprscan-20080809-16570641.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh13310 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02985.12.ls HEAT repeat 182.4 1.1e-51 10 PF02985.12.fs HEAT repeat 165.8 1e-46 11 PF03810.9.fs Importin-beta N-terminal domain 56.8 4.5e-15 1 PF03810.9.ls Importin-beta N-terminal domain 58.6 1.9e-14 1 PF00514.13.fs Armadillo/beta-catenin-like repeat 46.1 5.4e-12 5 PF00514.13.ls Armadillo/beta-catenin-like repeat 50.2 6.3e-12 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF03810.9.ls 1/1 195 263 .. 1 85 [] 58.6 1.9e-14 PF03810.9.fs 1/1 195 263 .. 1 85 [] 56.8 4.5e-15 PF02985.12.ls 2/10 286 321 .. 1 36 [] 18.4 0.024 PF02985.12.ls 3/10 331 367 .. 1 36 [] 13.0 0.98 PF02985.12.ls 4/10 373 408 .. 1 36 [] 25.2 0.00021 PF02985.12.fs 7/11 553 589 .. 1 36 [] 26.5 1.9e-06 PF02985.12.ls 6/10 553 589 .. 1 36 [] 28.5 2.3e-05 PF00514.13.ls 3/5 590 628 .. 1 41 [] 20.9 0.0042 PF02985.12.fs 8/11 594 630 .. 1 36 [] 30.2 1.7e-07 PF02985.12.ls 7/10 594 630 .. 1 36 [] 32.2 1.7e-06 PF02985.12.ls 8/10 636 672 .. 1 36 [] 19.2 0.014 PF02985.12.ls 9/10 823 859 .. 1 36 [] 26.9 6.4e-05 Alignments of top-scoring domains: PF03810.9.ls: domain 1 of 1, from 195 to 263: score 58.6, E = 1.9e-14 *->AEkqLeqlekqklPgFllaLlqIlansdtssdlqvRqlAalyLKNlI ++ L+q +++P+F+++L+++l++ +s+d+++R l++l+LKN++ fh13310 195 VQDKLKQ--LNQFPDFNNYLIFVLTRL-KSEDEPTRSLSGLILKNNV 238 trhWnshrkqggyeqrwlslpeeekeqIknnllnllgs<-* ++h+ s p+ + ++Ik+++ln +g+ fh13310 239 KAHYQ-------------SFPPPVADFIKQECLNNIGD 263 PF03810.9.fs: domain 1 of 1, from 195 to 263: score 56.8, E = 4.5e-15 *->AEkqLeqlekqklPgFllaLlqIlansdtssdlqvRqlAalyLKNlI ++ L+q +++P+F+++L+++l++ +s+d+++R l++l+LKN++ fh13310 195 VQDKLKQ--LNQFPDFNNYLIFVLTRL-KSEDEPTRSLSGLILKNNV 238 trhWnshrkqggyeqrwlslpeeekeqIknnllnllgs<-* ++h+ s p+ + ++Ik+++ln +g+ fh13310 239 KAHYQ-------------SFPPPVADFIKQECLNNIGD 263 PF02985.12.ls: domain 2 of 10, from 286 to 321: score 18.4, E = 0.024 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* + + ellp l++lln++d++ e A+ aL +++e fh13310 286 QmWP-ELLPQLCNLLNSEDYNTCEGAFGALQKICEDS 321 PF02985.12.ls: domain 3 of 10, from 331 to 367: score 13.0, E = 0.98 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* ++ l+ ++p +l+ +++ +p++R A+ ++ +++ fh13310 331 NrPLNIMIPKFLQFFKHCSPKIRSHAIACVNQFIMDR 367 PF02985.12.ls: domain 4 of 10, from 373 to 408: score 25.2, E = 0.00021 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* ++i +++++l+ l D+dpeVR+++++aL+ l+ev fh13310 373 DnID-TFIEHLFALAVDDDPEVRKNVCRALVMLLEVR 408 PF02985.12.fs: domain 7 of 11, from 553 to 589: score 26.5, E = 1.9e-06 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* e++l++llpll ll +p++ V+e+ + Lga+ae + fh13310 553 EeLLPHLLPLLKGLLFHPEWVVKESGILVLGAIAEGC 589 PF02985.12.ls: domain 6 of 10, from 553 to 589: score 28.5, E = 2.3e-05 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* e++l++llpll ll +p++ V+e+ + Lga+ae + fh13310 553 EeLLPHLLPLLKGLLFHPEWVVKESGILVLGAIAEGC 589 PF00514.13.ls: domain 3 of 5, from 590 to 628: score 20.9, E = 0.0042 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* + ++ e+ +p+L+q+Ls+++ v+ A+w+Ls a+ fh13310 590 MQGMVPYLPEL--IPHLIQCLSDKKALVRSIACWTLSRYAH 628 PF02985.12.fs: domain 8 of 11, from 594 to 630: score 30.2, E = 1.7e-07 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* ++l+el+p+l+++l+D+ + VR A+++L++ a + fh13310 594 VpYLPELIPHLIQCLSDKKALVRSIACWTLSRYAHWV 630 PF02985.12.ls: domain 7 of 10, from 594 to 630: score 32.2, E = 1.7e-06 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* ++l+el+p+l+++l+D+ + VR A+++L++ a + fh13310 594 VpYLPELIPHLIQCLSDKKALVRSIACWTLSRYAHWV 630 PF02985.12.ls: domain 8 of 10, from 636 to 672: score 19.2, E = 0.014 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* + +l+ l+ llk + D + +V+eaA++a+++l e + fh13310 636 DmHLKPLMTELLKRILDGNKRVQEAACSAFATLEEEA 672 PF02985.12.ls: domain 9 of 10, from 823 to 859: score 26.9, E = 6.4e-05 *->e.ildellplllkllnDpdpeVReaAaeaLgalaevl<-* ++++++ ll+++++D+ peVR++++ Lg+l + + fh13310 823 LvARSNIMTLLFQCMQDSMPEVRQSSFALLGDLTKAC 859 //