hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-17284759/chunk_1/iprscan-20080809-17284759.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh13607
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00856.18.fs SET domain                                      54.0    8.7e-15   1
PF05033.6.fs Pre-SET motif                                   14.3    0.00041   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF05033.6.fs   1/1      60    77 ..   107   123 .]    14.3  0.00041
PF00856.18.fs   1/1      79   126 ..     1    48 [.    54.0  8.7e-15

Alignments of top-scoring domains:
PF05033.6.fs: domain 1 of 1, from 60 to 77: score 14.3, E = 0.00041
                   *->IYECNsrCkCgp.sCkNR<-*
                      IYEC   CkC+++ C NR   
     fh13607    60    IYECSLLCKCNRqLCQNR    77   

PF00856.18.fs: domain 1 of 1, from 79 to 126: score 54.0, E = 8.7e-15
                   *->vqkgkwlrlegfkteikGwGlratedIpkGefiiEYpGelitseeae
                      vq+g ++rl++fkte+kGwG+r+++dI +G+f++ Y G l+++++ e
     fh13607    79    VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTE 125  

                   k<-*
                   k   
     fh13607   126 K    126  

//