hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-18201965/chunk_1/iprscan-20080809-18201965.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh14889 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07645.6.ls Calcium binding EGF domain 592.7 3.2e-175 14 PF07645.6.fs Calcium binding EGF domain 573.0 2.1e-173 14 PF00008.17.ls EGF-like domain 308.0 1.6e-89 14 PF00008.17.fs EGF-like domain 296.8 3.6e-86 14 PF00683.8.fs TB domain 192.3 7.6e-60 3 PF00683.8.ls TB domain 168.9 1.2e-47 3 PF01826.8.fs Trypsin Inhibitor like cysteine rich do 94.5 9.4e-30 12 PF07974.3.fs EGF-like domain 47.5 2.8e-12 9 PF09064.1.fs Thrombomodulin like fifth domain, EGF-l 41.7 2.1e-11 7 PF07974.3.ls EGF-like domain 46.8 6.8e-11 7 PF01607.14.fs Chitin binding Peritrophin-A domain 22.3 2.6e-06 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00683.8.ls 1/3 1 23 [. 1 45 [] 12.5 0.0012 PF00683.8.fs 1/3 1 23 [. 21 45 .] 39.8 7.5e-12 PF07645.6.fs 1/14 41 81 .. 1 55 [] 47.6 1.1e-13 PF07645.6.ls 1/14 41 81 .. 1 55 [] 49.4 1.2e-11 PF00008.17.ls 1/14 45 81 .. 1 38 [] 34.4 3.7e-07 PF00008.17.fs 1/14 45 81 .. 1 38 [] 32.4 3.5e-08 PF07645.6.ls 2/14 83 122 .. 1 55 [] 24.9 0.00027 PF00683.8.fs 2/3 139 182 .. 1 45 [] 79.5 2.5e-24 PF00683.8.ls 2/3 139 182 .. 1 45 [] 81.5 2.5e-21 PF07645.6.ls 3/14 201 241 .. 1 55 [] 47.3 4.7e-11 PF07645.6.fs 3/14 201 241 .. 1 55 [] 45.6 4.4e-13 PF00008.17.fs 3/14 205 241 .. 1 38 [] 26.0 2.2e-06 PF00008.17.ls 3/14 205 241 .. 1 38 [] 28.0 3.2e-05 PF07645.6.ls 4/14 243 282 .. 1 55 [] 55.5 1.7e-13 PF07645.6.fs 4/14 243 282 .. 1 55 [] 53.7 1.5e-15 PF00008.17.fs 4/14 247 280 .. 1 35 [. 24.7 5e-06 PF00008.17.ls 4/14 247 282 .. 1 38 [] 21.4 0.003 PF07645.6.fs 5/14 284 324 .. 1 55 [] 32.1 5.4e-09 PF07645.6.ls 5/14 284 324 .. 1 55 [] 33.9 5.3e-07 PF07645.6.fs 6/14 326 362 .. 1 50 [. 32.0 5.8e-09 PF07645.6.ls 6/14 326 363 .. 1 55 [] 29.2 1.3e-05 PF07645.6.fs 7/14 365 406 .. 1 55 [] 55.9 3.2e-16 PF07645.6.ls 7/14 365 406 .. 1 55 [] 57.7 3.6e-14 PF00008.17.fs 7/14 369 406 .. 1 38 [] 33.5 1.8e-08 PF00008.17.ls 7/14 369 406 .. 1 38 [] 35.4 1.8e-07 PF07645.6.ls 8/14 408 446 .. 1 55 [] 53.5 6.7e-13 PF07645.6.fs 8/14 408 446 .. 1 55 [] 51.8 5.8e-15 PF00008.17.ls 8/14 412 446 .. 1 38 [] 20.8 0.0044 PF07645.6.fs 9/14 448 488 .. 1 55 [] 49.5 2.8e-14 PF07645.6.ls 9/14 448 488 .. 1 55 [] 51.3 3e-12 PF00008.17.ls 9/14 452 488 .. 1 38 [] 29.8 8.8e-06 PF00008.17.fs 9/14 452 488 .. 1 38 [] 27.9 6.7e-07 PF00683.8.ls 3/3 503 545 .. 1 45 [] 75.0 2.2e-19 PF00683.8.fs 3/3 503 545 .. 1 45 [] 73.0 2.7e-22 PF07645.6.ls 10/14 562 599 .. 1 55 [] 39.7 9.2e-09 PF07645.6.fs 10/14 562 599 .. 1 55 [] 38.0 8.7e-11 PF07645.6.ls 11/14 601 639 .. 1 55 [] 31.4 2.9e-06 PF07645.6.fs 11/14 601 639 .. 1 55 [] 29.7 3e-08 PF00008.17.ls 11/14 605 639 .. 1 38 [] 24.3 0.00039 PF07645.6.fs 12/14 641 680 .. 1 55 [] 44.7 8e-13 PF07645.6.ls 12/14 641 680 .. 1 55 [] 46.5 8.5e-11 PF00008.17.ls 12/14 645 680 .. 1 38 [] 19.9 0.0086 PF07645.6.ls 13/14 682 724 .. 1 55 [] 39.6 9.8e-09 PF07645.6.fs 13/14 682 724 .. 1 55 [] 37.9 9.8e-11 PF07645.6.fs 14/14 726 766 .. 1 55 [] 31.2 1e-08 PF07645.6.ls 14/14 726 766 .. 1 55 [] 32.9 1e-06 PF00008.17.ls 14/14 730 766 .. 1 38 [] 20.2 0.0069 Alignments of top-scoring domains: PF00683.8.ls: domain 1 of 3, from 1 to 23: score 12.5, E = 0.0012 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- +G+ AWGtpCE+CP+++t e+k L fh14889 1 --------------------LGK--AWGTPCEMCPAVNTSEYKIL 23 * fh14889 - - PF00683.8.fs: domain 1 of 3, from 1 to 23: score 39.8, E = 7.5e-12 *->vGrgeAWGtpCElCPvpgtaefkeL<-* +G+ AWGtpCE+CP+++t e+k L fh14889 1 LGK--AWGTPCEMCPAVNTSEYKIL 23 PF07645.6.fs: domain 1 of 14, from 41 to 81: score 47.6, E = 1.1e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + C ++++C+Nt GSF+C+ Cp GY fh14889 41 DIDECQELP-GLC----QGGKCINTFGSFQCR----CPTGYY----- 73 nnedgtnC<-* ned +C fh14889 74 LNEDTRVC 81 PF07645.6.ls: domain 1 of 14, from 41 to 81: score 49.4, E = 1.2e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + C ++++C+Nt GSF+C+ Cp GY fh14889 41 DIDECQELP-GLC----QGGKCINTFGSFQCR----CPTGYY----- 73 nnedgtnC<-* ned +C fh14889 74 LNEDTRVC 81 PF00008.17.ls: domain 1 of 14, from 45 to 81: score 34.4, E = 3.7e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ +g C++ G+C++t g+++C+Cp Gy+l+ + + C fh14889 45 CQELPGLCQG-GKCINTFGSFQCRCPTGYYLNEDTRVC 81 PF00008.17.fs: domain 1 of 14, from 45 to 81: score 32.4, E = 3.5e-08 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ +g C++ G+C++t g+++C+Cp Gy+l+ + + C fh14889 45 CQELPGLCQG-GKCINTFGSFQCRCPTGYYLNEDTRVC 81 PF07645.6.ls: domain 2 of 14, from 83 to 122: score 24.9, E = 0.00027 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse Dv+EC++++ +C+ ++C Nt+G ++C Cp+ Y fh14889 83 DVNECETPG--ICG----PGTCYNTVGNYTCI----CPPDYM----- 114 nnedgtnC<-* +g+nC fh14889 115 QVNGGNNC 122 PF00683.8.fs: domain 2 of 3, from 139 to 182: score 79.5, E = 2.5e-24 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- ++C+++l ++ +TK++CCCs++ g+AW++pCE+CP+p t+ef++L fh14889 139 QTCDGELLFN-MTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATL 182 * fh14889 - - PF00683.8.ls: domain 2 of 3, from 139 to 182: score 81.5, E = 2.5e-21 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- ++C+++l ++ +TK++CCCs++ g+AW++pCE+CP+p t+ef++L fh14889 139 QTCDGELLFN-MTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATL 182 * fh14889 - - PF07645.6.ls: domain 3 of 14, from 201 to 241: score 47.3, E = 4.7e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC++ + +C +n+vC+N +GSF+C+ Cp G+ fh14889 201 DIDECREIP-GVC----ENGVCINMVGSFRCE----CPVGFF----- 233 nnedgtnC<-* n+ +C fh14889 234 YNDKLLVC 241 PF07645.6.fs: domain 3 of 14, from 201 to 241: score 45.6, E = 4.4e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC++ + +C +n+vC+N +GSF+C+ Cp G+ fh14889 201 DIDECREIP-GVC----ENGVCINMVGSFRCE----CPVGFF----- 233 nnedgtnC<-* n+ +C fh14889 234 YNDKLLVC 241 PF00008.17.fs: domain 3 of 14, from 205 to 241: score 26.0, E = 2.2e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C + +g C n G C++ g+++CeCp+G+f++ + C fh14889 205 CREIPGVCEN-GVCINMVGSFRCECPVGFFYNDKLLVC 241 PF00008.17.ls: domain 3 of 14, from 205 to 241: score 28.0, E = 3.2e-05 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C + +g C n G C++ g+++CeCp+G+f++ + C fh14889 205 CREIPGVCEN-GVCINMVGSFRCECPVGFFYNDKLLVC 241 PF07645.6.ls: domain 4 of 14, from 243 to 282: score 55.5, E = 1.7e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +g+ +C ++n++C+Nt GS++C C++GY+ fh14889 243 DIDECQNGP--VC---QRNAECINTAGSYRCD----CKPGYR----- 275 nnedgtnC<-* + ++C fh14889 276 -FTSTGQC 282 PF07645.6.fs: domain 4 of 14, from 243 to 282: score 53.7, E = 1.5e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +g+ +C ++n++C+Nt GS++C C++GY+ fh14889 243 DIDECQNGP--VC---QRNAECINTAGSYRCD----CKPGYR----- 275 nnedgtnC<-* + ++C fh14889 276 -FTSTGQC 282 PF00008.17.fs: domain 4 of 14, from 247 to 280: score 24.7, E = 5e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytG<-* C+ + C+ +++C++t g+y+C+C+pGy++ tG fh14889 247 CQNGP-VCQRNAECINTAGSYRCDCKPGYRFTSTG 280 PF00008.17.ls: domain 4 of 14, from 247 to 282: score 21.4, E = 0.003 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ + C+ +++C++t g+y+C+C+pGy++ tG +C fh14889 247 CQNGP-VCQRNAECINTAGSYRCDCKPGYRFTSTG-QC 282 PF07645.6.fs: domain 5 of 14, from 284 to 324: score 32.1, E = 5.4e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + + ++C + C+ t+GSF+C+ C G++ fh14889 284 DRNECQEIP-NIC----SHGQCIDTVGSFYCL----CHTGFK----- 316 nnedgtnC<-* +n+d t C fh14889 317 TNDDQTMC 324 PF07645.6.ls: domain 5 of 14, from 284 to 324: score 33.9, E = 5.3e-07 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + + ++C + C+ t+GSF+C+ C G++ fh14889 284 DRNECQEIP-NIC----SHGQCIDTVGSFYCL----CHTGFK----- 316 nnedgtnC<-* +n+d t C fh14889 317 TNDDQTMC 324 PF07645.6.fs: domain 6 of 14, from 326 to 362: score 32.0, E = 5.8e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ + C+ n++C NtiGSF+C+ C +G+ s fh14889 326 DINECER---DACG----NGTCRNTIGSFNCR----CNHGFI--LSH 359 nne<-* nn+ fh14889 360 NND 362 PF07645.6.ls: domain 6 of 14, from 326 to 363: score 29.2, E = 1.3e-05 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ + C+ n++C NtiGSF+C+ C +G+ fh14889 326 DINECER---DACG----NGTCRNTIGSFNCR----CNHGFI----- 356 nnedgtnC<-* ++ C fh14889 357 -LSHNNDC 363 PF07645.6.fs: domain 7 of 14, from 365 to 406: score 55.9, E = 3.2e-16 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+g + C +n+ C+Nt+GSF+C+ C eGYe fh14889 365 DVDECASGNGNLC----RNGQCINTVGSFQCQ----CNEGYE----- 398 nnedgtnC<-* + +dg +C fh14889 399 VAPDGRTC 406 PF07645.6.ls: domain 7 of 14, from 365 to 406: score 57.7, E = 3.6e-14 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDECa+g + C +n+ C+Nt+GSF+C+ C eGYe fh14889 365 DVDECASGNGNLC----RNGQCINTVGSFQCQ----CNEGYE----- 398 nnedgtnC<-* + +dg +C fh14889 399 VAPDGRTC 406 PF00008.17.fs: domain 7 of 14, from 369 to 406: score 33.5, E = 1.8e-08 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n++ C n G+C++t g+++C+C +Gy ++ +G++C fh14889 369 CASGNgNLCRN-GQCINTVGSFQCQCNEGYEVAPDGRTC 406 PF00008.17.ls: domain 7 of 14, from 369 to 406: score 35.4, E = 1.8e-07 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n++ C n G+C++t g+++C+C +Gy ++ +G++C fh14889 369 CASGNgNLCRN-GQCINTVGSFQCQCNEGYEVAPDGRTC 406 PF07645.6.ls: domain 8 of 14, from 408 to 446: score 53.5, E = 6.7e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + C a ++C+N +GS++C Cp+GY+ fh14889 408 DINECLLEP-RKC----APGTCQNLDGSYRCI----CPPGYS----- 440 nnedgtnC<-* +++C fh14889 441 --LQNEKC 446 PF07645.6.fs: domain 8 of 14, from 408 to 446: score 51.8, E = 5.8e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + C a ++C+N +GS++C Cp+GY+ fh14889 408 DINECLLEP-RKC----APGTCQNLDGSYRCI----CPPGYS----- 440 nnedgtnC<-* +++C fh14889 441 --LQNEKC 446 PF00008.17.ls: domain 8 of 14, from 412 to 446: score 20.8, E = 0.0044 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C ++ C GtC++++g+y+C+CppG ++ + ++C fh14889 412 CLLEPRKCAP-GTCQNLDGSYRCICPPG--YSLQNEKC 446 PF07645.6.fs: domain 9 of 14, from 448 to 488: score 49.5, E = 2.8e-14 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + +C a ++C Nt+GSF+C+ CpeG++ fh14889 448 DIDECVEEP-EIC----ALGTCSNTEGSFKCL----CPEGFS----- 480 nnedgtnC<-* g C fh14889 481 LSSSGRRC 488 PF07645.6.ls: domain 9 of 14, from 448 to 488: score 51.3, E = 3e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + +C a ++C Nt+GSF+C+ CpeG++ fh14889 448 DIDECVEEP-EIC----ALGTCSNTEGSFKCL----CPEGFS----- 480 nnedgtnC<-* g C fh14889 481 LSSSGRRC 488 PF00008.17.ls: domain 9 of 14, from 452 to 488: score 29.8, E = 8.8e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C +++ C GtC +t+g+++C Cp+G+ l+ +G+rC fh14889 452 CVEEPEICAL-GTCSNTEGSFKCLCPEGFSLSSSGRRC 488 PF00008.17.fs: domain 9 of 14, from 452 to 488: score 27.9, E = 6.7e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C +++ C GtC +t+g+++C Cp+G+ l+ +G+rC fh14889 452 CVEEPEICAL-GTCSNTEGSFKCLCPEGFSLSSSGRRC 488 PF00683.8.ls: domain 3 of 3, from 503 to 545: score 75.0, E = 2.2e-19 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- g+Cs p++ + ++K+eCCC++ ge+WG+pCElCP+++ ++f+++ fh14889 503 GKCSSPKSRN-HSKQECCCALK-GEGWGDPCELCPTEPDEAFRQI 545 * fh14889 - - PF00683.8.fs: domain 3 of 3, from 503 to 545: score 73.0, E = 2.7e-22 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- g+Cs p++ + ++K+eCCC++ ge+WG+pCElCP+++ ++f+++ fh14889 503 GKCSSPKSRN-HSKQECCCALK-GEGWGDPCELCPTEPDEAFRQI 545 * fh14889 - - PF07645.6.ls: domain 10 of 14, from 562 to 599: score 39.7, E = 9.2e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC ++ +C + + C+Nt+GS++C+ Cp GY fh14889 562 DMDECKEPD--VC----KHGQCINTDGSYRCE----CPFGYI----- 593 nnedgtnC<-* g++C fh14889 594 --LAGNEC 599 PF07645.6.fs: domain 10 of 14, from 562 to 599: score 38.0, E = 8.7e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC ++ +C + + C+Nt+GS++C+ Cp GY fh14889 562 DMDECKEPD--VC----KHGQCINTDGSYRCE----CPFGYI----- 593 nnedgtnC<-* g++C fh14889 594 --LAGNEC 599 PF07645.6.ls: domain 11 of 14, from 601 to 639: score 31.4, E = 2.9e-06 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC g C+ n++C N iG+FeC+ C+eG+e fh14889 601 DTDECSVGN--PCG----NGTCKNVIGGFECT----CEEGFE----- 632 nnedgtnC<-* ++ +C fh14889 633 -PGPMMTC 639 PF07645.6.fs: domain 11 of 14, from 601 to 639: score 29.7, E = 3e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC g C+ n++C N iG+FeC+ C+eG+e fh14889 601 DTDECSVGN--PCG----NGTCKNVIGGFECT----CEEGFE----- 632 nnedgtnC<-* ++ +C fh14889 633 -PGPMMTC 639 PF00008.17.ls: domain 11 of 14, from 605 to 639: score 24.3, E = 0.00039 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* Cs n pC n GtC ++ gg++C C +G f + + +C fh14889 605 CSVGN-PCGN-GTCKNVIGGFECTCEEG-FEPGPMMTC 639 PF07645.6.fs: domain 12 of 14, from 641 to 680: score 44.7, E = 8e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++ECa+ + C ++ CvNt+GS+eC Cp GY fh14889 641 DINECAQNP-LLC-----AFRCVNTYGSYECK----CPVGYV----- 672 nnedgtnC<-* ed+ C fh14889 673 LREDRRMC 680 PF07645.6.ls: domain 12 of 14, from 641 to 680: score 46.5, E = 8.5e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++ECa+ + C ++ CvNt+GS+eC Cp GY fh14889 641 DINECAQNP-LLC-----AFRCVNTYGSYECK----CPVGYV----- 672 nnedgtnC<-* ed+ C fh14889 673 LREDRRMC 680 PF00008.17.ls: domain 12 of 14, from 645 to 680: score 19.9, E = 0.0086 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++n+ C +Cv+t g+y+C+Cp+Gy+l + + C fh14889 645 CAQNPLLCAF--RCVNTYGSYECKCPVGYVLREDRRMC 680 PF07645.6.ls: domain 13 of 14, from 682 to 724: score 39.6, E = 9.8e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC++g+ h+C + + ++C N iG++ C C +GY+ fh14889 682 DEDECEEGK-HDC--TEKQMECKNLIGTYMCI----CGPGYQ----- 716 nnedgtnC<-* +dg+ C fh14889 717 RRPDGEGC 724 PF07645.6.fs: domain 13 of 14, from 682 to 724: score 37.9, E = 9.8e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D DEC++g+ h+C + + ++C N iG++ C C +GY+ fh14889 682 DEDECEEGK-HDC--TEKQMECKNLIGTYMCI----CGPGYQ----- 716 nnedgtnC<-* +dg+ C fh14889 717 RRPDGEGC 724 PF07645.6.fs: domain 14 of 14, from 726 to 766: score 31.2, E = 1e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + + +C +n+ C+Nt GS++C+ C +G++ fh14889 726 DENECQTKP-GIC----ENGRCLNTRGSYTCE----CNDGFT----- 758 nnedgtnC<-* + ++ ++C fh14889 759 ASPNQDEC 766 PF07645.6.ls: domain 14 of 14, from 726 to 766: score 32.9, E = 1e-06 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D +EC + + +C +n+ C+Nt GS++C+ C +G++ fh14889 726 DENECQTKP-GIC----ENGRCLNTRGSYTCE----CNDGFT----- 758 nnedgtnC<-* + ++ ++C fh14889 759 ASPNQDEC 766 PF00008.17.ls: domain 14 of 14, from 730 to 766: score 20.2, E = 0.0069 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ +g C n G+C++t+g+ytCeC G+ + +++ C fh14889 730 CQTKPGICEN-GRCLNTRGSYTCECNDGFTASPNQDEC 766 //