hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-08413201/chunk_1/iprscan-20090618-08413201.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh15286
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00391                                                  30.5    7.8e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00391    1/1      17    91 ..     1    87 []    30.5  7.8e-05

Alignments of top-scoring domains:
SM00391: domain 1 of 1, from 17 to 91: score 30.5, E = 7.8e-05
                   *->edelrlPaLppGWrRetvqRksgKKssagkgDVyYisPcGkkLRsks
                      + ++ ++ +p GW R ++            g V YisP+G  L+s  
     fh15286    17    GGPVATS-VPIGWQRCVR-----------EGAVLYISPSGTELSSLE 51   

                   ElarYLhkngdlslaledPLRPEYlFdFnarvpvgpkitp<-*
                   +   YL   g+++++le+PL     F F++  pv p       
     fh15286    52 QTRSYLLSDGTCKCGLECPLNVPKVFNFDPLAPVTPGGAG    91   

//