hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-19453976/chunk_1/iprscan-20080809-19453976.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh16409 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00020.9.fs TNFR/NGFR cysteine-rich region 97.5 4.7e-28 3 PF00020.9.ls TNFR/NGFR cysteine-rich region 97.5 3.6e-26 2 PF00531.12.ls Death domain 79.2 1.2e-20 1 PF00531.12.fs Death domain 77.2 1.6e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00020.9.ls 1/2 112 154 .. 1 42 [] 57.6 3.9e-14 PF00020.9.fs 2/3 112 154 .. 1 42 [] 55.6 1.2e-15 PF00020.9.fs 3/3 156 192 .. 1 42 [] 38.1 1.8e-10 PF00020.9.ls 2/2 156 192 .. 1 42 [] 40.0 7.7e-09 PF00531.12.fs 1/1 258 341 .. 1 87 [] 77.2 1.6e-20 PF00531.12.ls 1/1 258 341 .. 1 87 [] 79.2 1.2e-20 Alignments of top-scoring domains: PF00020.9.ls: domain 1 of 2, from 112 to 154: score 57.6, E = 3.9e-14 *->CeegvtYtdenhv.pqClsCskCepemGqvlvspCtatqnTvC<-* C+eg++Ytd++h++++C++C++C++++G+++ +Ct+tqnT+C fh16409 112 CQEGKEYTDKAHFsSKCRRCRLCDEGHGLEVEINCTRTQNTKC 154 PF00020.9.fs: domain 2 of 3, from 112 to 154: score 55.6, E = 1.2e-15 *->CeegvtYtdenhv.pqClsCskCepemGqvlvspCtatqnTvC<-* C+eg++Ytd++h++++C++C++C++++G+++ +Ct+tqnT+C fh16409 112 CQEGKEYTDKAHFsSKCRRCRLCDEGHGLEVEINCTRTQNTKC 154 PF00020.9.fs: domain 3 of 3, from 156 to 192: score 38.1, E = 1.8e-10 *->CeegvtYtd.enhvpqClsCskCepemGqvlvspCtatqnTvC<-* C+++ +++ ++ + ++C +C+kCe+ G +++Ct t+nT+C fh16409 156 CKPN-FFCNsTVC-EHCDPCTKCEH--GI--IKECTLTSNTKC 192 PF00020.9.ls: domain 2 of 2, from 156 to 192: score 40.0, E = 7.7e-09 *->CeegvtYtd.enhvpqClsCskCepemGqvlvspCtatqnTvC<-* C+++ +++ ++ + ++C +C+kCe+ G +++Ct t+nT+C fh16409 156 CKPN-FFCNsTVC-EHCDPCTKCEH--GI--IKECTLTSNTKC 192 PF00531.12.fs: domain 1 of 1, from 258 to 341: score 77.2, E = 1.6e-20 *->eklcallDpdellgkdWkeLArkLglseneIdeiesdenpgdlrspt +++ ++ ++ ++ k ++rk+g+ e++Idei++ +n +d+++++ fh16409 258 KYITTIA--GVMTLSQVKGFVRKNGVNEAKIDEIKN-DNVQDTAEQK 301 yeLLrlWeqrhGknatvgtLleaLrklgrrdaaellesal<-* ++LLr+W q hGk+ +++tL++ L+k++++ +ae+++ ++ fh16409 302 VQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTII 341 PF00531.12.ls: domain 1 of 1, from 258 to 341: score 79.2, E = 1.2e-20 *->eklcallDpdellgkdWkeLArkLglseneIdeiesdenpgdlrspt +++ ++ ++ ++ k ++rk+g+ e++Idei++ +n +d+++++ fh16409 258 KYITTIA--GVMTLSQVKGFVRKNGVNEAKIDEIKN-DNVQDTAEQK 301 yeLLrlWeqrhGknatvgtLleaLrklgrrdaaellesal<-* ++LLr+W q hGk+ +++tL++ L+k++++ +ae+++ ++ fh16409 302 VQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTII 341 //