hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-19453976/chunk_1/iprscan-20080809-19453976.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh16409 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00208 88.7 6.9e-22 3 SM00005 87.6 1.4e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00208 1/3 76 109 .. 1 50 [] 3.6 47 SM00208 2/3 112 154 .. 1 50 [] 50.3 2.5e-10 SM00208 3/3 156 192 .. 1 50 [] 34.7 1.2e-05 SM00005 1/1 245 341 .. 1 108 [] 87.6 1.4e-21 Alignments of top-scoring domains: SM00208: domain 1 of 3, from 76 to 109: score 3.6, E = 47 *->CkegegtYtddgnhssrlpkClpCthtrCppehmGqvvkspCta.ts eg ++d + +C + +Cpp G++ ++Ct + + fh16409 76 -L--EGLHHDGQ-------FC--HK--PCPP---GERKARDCTVnGD 105 dTvC<-* C fh16409 106 EPDC 109 SM00208: domain 2 of 3, from 112 to 154: score 50.3, E = 2.5e-10 *->CkegegtYtddgnhssrlpkClpCthtrCppehmGqvvkspCtatsd C+e +++Ytd+ + s +kC++C+ C++ h G++v +Ct+t++ fh16409 112 CQE-GKEYTDKAHFS---SKCRRCR--LCDEGH-GLEVEINCTRTQN 151 TvC<-* T+C fh16409 152 TKC 154 SM00208: domain 3 of 3, from 156 to 192: score 34.7, E = 1.2e-05 *->CkegegtYtddgnhssrlpkClpCthtrCppehmGqvvkspCtatsd Ck +++++++ + ++C pCt +C++ + +++Ct ts+ fh16409 156 CK--PNFFCNSTVC----EHCDPCT--KCEH-----GIIKECTLTSN 189 TvC<-* T+C fh16409 190 TKC 192 SM00005: domain 1 of 1, from 245 to 341: score 87.6, E = 1.4e-21 *->pagaaslteltreklaklldhpldlgddWreLArkLglseaeidqie + a++l+++++ k ++ ++ ++ ++ + ++rk+g+ ea+id+i+ fh16409 245 ETVAINLSDVDLSKYITTIAG-VMTLSQVKGFVRKNGVNEAKIDEIK 290 tesprelnAyyeddlreqsyqlLrlWeqregkneqatlgtLleaLrkmgr +++ + d++eq++qlLr+W q +gk+ +++tL++ L+k+++ fh16409 291 NDNVQ--------DTAEQKVQLLRNWHQLHGKK--EAYDTLIKDLKKANL 330 ddavellrsel<-* + ++e++++ + fh16409 331 CTLAEKIQTII 341 //