hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-21552357/chunk_1/iprscan-20080809-21552357.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh18469
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N 
--------        -----------                             -----    ------- ---
PF00418.9.ls    Tau and MAP protein, tubulin-binding    221.9    1.3e-63   4
PF00418.9.fs    Tau and MAP protein, tubulin-binding    214.0    9.6e-63   4

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
PF00418.9.fs      1/4     951   981 ..     1    32 []    54.8  1.9e-15
PF00418.9.ls      1/4     951   981 ..     1    32 []    56.7  6.9e-14
PF00418.9.ls      2/4    1020  1050 ..     1    32 []    63.7  5.5e-16
PF00418.9.fs      2/4    1020  1050 ..     1    32 []    61.8  1.6e-17
PF00418.9.fs      3/4    1051  1081 ..     1    32 []    61.0  2.7e-17
PF00418.9.ls      3/4    1051  1081 ..     1    32 []    63.0  9.3e-16
PF00418.9.ls      4/4    1082  1113 ..     1    32 []    38.5  2.2e-08
PF00418.9.fs      4/4    1082  1113 ..     1    32 []    36.5    5e-10

Alignments of top-scoring domains:
PF00418.9.fs: domain 1 of 4, from 951 to 981: score 54.8, E = 1.9e-15
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      ++ +++++ Dlk+V+SK+GS++NikHqPGGG+   
     fh18469   951    LATNTSAP-DLKNVRSKVGSTENIKHQPGGGR    981  

PF00418.9.ls: domain 1 of 4, from 951 to 981: score 56.7, E = 6.9e-14
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      ++ +++++ Dlk+V+SK+GS++NikHqPGGG+   
     fh18469   951    LATNTSAP-DLKNVRSKVGSTENIKHQPGGGR    981  

PF00418.9.ls: domain 2 of 4, from 1020 to 1050: score 63.7, E = 5.5e-16
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqiv+kk+ +++++qSK+GSkdNikH+PGGGn   
     fh18469  1020    VQIVSKKV-SYSHIQSKCGSKDNIKHVPGGGN    1050 

PF00418.9.fs: domain 2 of 4, from 1020 to 1050: score 61.8, E = 1.6e-17
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqiv+kk+ +++++qSK+GSkdNikH+PGGGn   
     fh18469  1020    VQIVSKKV-SYSHIQSKCGSKDNIKHVPGGGN    1050 

PF00418.9.fs: domain 3 of 4, from 1051 to 1081: score 61.0, E = 2.7e-17
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqi+nkk+ D++kV+SK+GSk NikH+PGGG+   
     fh18469  1051    VQIQNKKV-DISKVSSKCGSKANIKHKPGGGD    1081 

PF00418.9.ls: domain 3 of 4, from 1051 to 1081: score 63.0, E = 9.3e-16
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqi+nkk+ D++kV+SK+GSk NikH+PGGG+   
     fh18469  1051    VQIQNKKV-DISKVSSKCGSKANIKHKPGGGD    1081 

PF00418.9.ls: domain 4 of 4, from 1082 to 1113: score 38.5, E = 2.2e-08
                   *->vqivnkklPDlk.kVqSKiGSkdNikHqPGGGn<-*
                      v+i+++kl  +k+k q+K+GS+dN+ H P GG    
     fh18469  1082    VKIESQKL-NFKeKAQAKVGSLDNVGHLPAGGA    1113 

PF00418.9.fs: domain 4 of 4, from 1082 to 1113: score 36.5, E = 5e-10
                   *->vqivnkklPDlk.kVqSKiGSkdNikHqPGGGn<-*
                      v+i+++kl  +k+k q+K+GS+dN+ H P GG    
     fh18469  1082    VKIESQKL-NFKeKAQAKVGSLDNVGHLPAGGA    1113 

//