hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-23004778/chunk_1/iprscan-20080809-23004778.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh19454
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
SM00443                                                  86.6      3e-21   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
SM00443     1/1     431   477 ..     1    48 []    86.6    3e-21

Alignments of top-scoring domains:
SM00443: domain 1 of 1, from 431 to 477: score 86.6, E = 3e-21
                   *->istsniGaklLekMGWkeGkGLGkneqGivePIeakikkkdrkGLGa
                      i++sniG+k+L++MGW+eG GLG++ qGi+ PIea+++  +++GLGa
     fh19454   431    IDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVR-LKGAGLGA 476  

                   v<-*
                   +   
     fh19454   477 K    477  

//